(data stored in ACNUC7421 zone)

EMBL: CP001111.PE475

CP001111.PE475       Location/Qualifiers
FT   CDS             complement(556763..557110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50180"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH5"
FT                   /protein_id="ACF50180.1"
FT                   /translation="MAAAFSDRFSDATRQLAAAATRANRLALENAESMFGVQLKVMERN
FT                   LTATGGWLGELARGEDAAGTLSKGAQLWQDNLQRLGQAQQDVVGLGLQASKAWSELVQG
FT                   YNQSTADASNH"
     MAAAFSDRFS DATRQLAAAA TRANRLALEN AESMFGVQLK VMERNLTATG GWLGELARGE        60
     DAAGTLSKGA QLWQDNLQRL GQAQQDVVGL GLQASKAWSE LVQGYNQSTA DASNH            115
//

If you have problems or comments...

PBIL Back to PBIL home page