(data stored in ACNUC7421 zone)

EMBL: CP001111.PE477

CP001111.PE477       Location/Qualifiers
FT   CDS             557781..560420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0477"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC3613 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50182"
FT                   /db_xref="GOA:B4SIH7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH7"
FT                   /protein_id="ACF50182.1"
FT                   /translation="MPKHTLLVAALAVALAAPLSAAAETSADASGEASTLAAVRVTGSN
FT                   IKRADTEASNPVQVIGRQQLEQTGKATVADVLRSISANTGNASNETTNNGWASGSAGIG
FT                   LRGLSQKNTLVLLNGRRLANYGFPAGGLSDTFVDLNALPLVAVERIEVLKDGASAVYGS
FT                   DAVAGVVNIITRQNFEGAEIGGSFGGADQGGLHEQNLKFVGGLGDLDTDGYNILFSLQG
FT                   YNRERLDQDERNLTKSGIYTDKPGGRWNGWSAKGARYLVNGVSVPMLDASGNCPAGTTR
FT                   VASAPIDGLAGDTCGFNQAPFTTLIPSTKRYQAYANGTFRLNDNVEAFGEVLYSQIKST
FT                   AWFGSSPFFTLESGRFALNADSGLAEPVTSLLPASNPYNPYGRAIPIEYTFFDLGGTLK
FT                   TNRSTAYRGVFGLRGTTAKWDWEVAAFGARSSERESVSGGFANRWALADALATGSYNLL
FT                   NPAATPQSVRDSINIATLRPAESKLQGIDAKISGSLGHTWAGEIGFAAGAEWRREKLDS
FT                   NNPWQIDAGLQVRPAIAEVHGKRQVSAAYAEVNVPLASTLELSAAARADHYDDFGDAFS
FT                   PKIGLRWQPLDFLLVRASASKGFRAPSLSENSNSTSIAYGSVVDPRDPDVPGSRQNPTF
FT                   FTVGNNELKPERTKSLNFGVVLSPWANTNLSVDYYRIQLDNLVGTNNTQTLVNDNVAGA
FT                   VQRDERGKLQAVYNRYQNLSELKTSGIDVELRQRIPTAAFGDFTVSSAYTHVRDYRRPT
FT                   VVGGPLVDYAGSNLGATLPKDKATTTLDWKYGDFNAAVTWYYTSSYRQEASTAAKAVQQ
FT                   QVGSYSQYDLYLAYTGIDKLTVYAKVQNLADKTPPYDASFPGIRAPYDFSQYDLRGRYF
FT                   TLGFDYRF"
     MPKHTLLVAA LAVALAAPLS AAAETSADAS GEASTLAAVR VTGSNIKRAD TEASNPVQVI        60
     GRQQLEQTGK ATVADVLRSI SANTGNASNE TTNNGWASGS AGIGLRGLSQ KNTLVLLNGR       120
     RLANYGFPAG GLSDTFVDLN ALPLVAVERI EVLKDGASAV YGSDAVAGVV NIITRQNFEG       180
     AEIGGSFGGA DQGGLHEQNL KFVGGLGDLD TDGYNILFSL QGYNRERLDQ DERNLTKSGI       240
     YTDKPGGRWN GWSAKGARYL VNGVSVPMLD ASGNCPAGTT RVASAPIDGL AGDTCGFNQA       300
     PFTTLIPSTK RYQAYANGTF RLNDNVEAFG EVLYSQIKST AWFGSSPFFT LESGRFALNA       360
     DSGLAEPVTS LLPASNPYNP YGRAIPIEYT FFDLGGTLKT NRSTAYRGVF GLRGTTAKWD       420
     WEVAAFGARS SERESVSGGF ANRWALADAL ATGSYNLLNP AATPQSVRDS INIATLRPAE       480
     SKLQGIDAKI SGSLGHTWAG EIGFAAGAEW RREKLDSNNP WQIDAGLQVR PAIAEVHGKR       540
     QVSAAYAEVN VPLASTLELS AAARADHYDD FGDAFSPKIG LRWQPLDFLL VRASASKGFR       600
     APSLSENSNS TSIAYGSVVD PRDPDVPGSR QNPTFFTVGN NELKPERTKS LNFGVVLSPW       660
     ANTNLSVDYY RIQLDNLVGT NNTQTLVNDN VAGAVQRDER GKLQAVYNRY QNLSELKTSG       720
     IDVELRQRIP TAAFGDFTVS SAYTHVRDYR RPTVVGGPLV DYAGSNLGAT LPKDKATTTL       780
     DWKYGDFNAA VTWYYTSSYR QEASTAAKAV QQQVGSYSQY DLYLAYTGID KLTVYAKVQN       840
     LADKTPPYDA SFPGIRAPYD FSQYDLRGRY FTLGFDYRF                              879
//

If you have problems or comments...

PBIL Back to PBIL home page