(data stored in ACNUC7421 zone)

EMBL: CP001111.PE48

CP001111.PE48        Location/Qualifiers
FT   CDS             complement(55891..56619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0326 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49753"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN3"
FT                   /protein_id="ACF49753.1"
FT                   /translation="MKAKHAPLCLLLGLSMAAAVTARECPVEAPRQIPPTVLTGGFFDA
FT                   HPDLFWRSMAQRAERDKRPARALDYYKRSARYADKFSQAMVARLYQEGIGTRADPVMAY
FT                   IWMDLAAERMYHDFLVLREHYWARLDALQQAQAIERGQQVYADYGDRVAKPRMERALRD
FT                   GRQQITGSRLGYVSSGLIVVQRRGNEQGIATPGSIVYDNDYWRAADYWCLQDNYWRPAL
FT                   TPSVEIGRPDTVRDDKAVGD"
     MKAKHAPLCL LLGLSMAAAV TARECPVEAP RQIPPTVLTG GFFDAHPDLF WRSMAQRAER        60
     DKRPARALDY YKRSARYADK FSQAMVARLY QEGIGTRADP VMAYIWMDLA AERMYHDFLV       120
     LREHYWARLD ALQQAQAIER GQQVYADYGD RVAKPRMERA LRDGRQQITG SRLGYVSSGL       180
     IVVQRRGNEQ GIATPGSIVY DNDYWRAADY WCLQDNYWRP ALTPSVEIGR PDTVRDDKAV       240
     GD                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page