(data stored in ACNUC7421 zone)

EMBL: CP001111.PE480

CP001111.PE480       Location/Qualifiers
FT   CDS             complement(564863..566278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0480"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   xcv:XCV3733 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50185"
FT                   /db_xref="GOA:B4SII0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII0"
FT                   /protein_id="ACF50185.1"
FT                   /translation="MSFESLGLAPFLLRALAEQGYETPTPIQQQAIPLVLAGRDLLAGA
FT                   QTGTGKTAAFGLPLLQHLGTASQEVRTGPRKPRALILAPTRELATQVHDSLRGYSKYLR
FT                   IPSACIYGGVGMGNQLDILRRGVDLLVACPGRLIDHLERRSIDLSGIELLVLDEADRML
FT                   DMGFLPSIKRILAKLPKQNRQTLLFSATFEDNIRQLALEFMRNPEQIQVTPKNTVAETI
FT                   THRVHPVDGGRKRDLLLHLLAQDSREQTLVFARTKHGSDKLAAFLEKSGIKTAAIHGNK
FT                   SQGQRLRALGDFKAGRVTVLVATDIAARGIDINELPKVINFDLPMVAEDYVHRIGRTGR
FT                   NGATGQAISLVAQDEVKLLRAITRLLGRDMDIRDVPGFELQVPIRWGNSAPGKAEHETG
FT                   ERAPRKNHARRPHGDAPRHAHAGPKKAGGGRREGGGNGQQRAGAGAGQGQRRGGAGNGG
FT                   GRGRGQGGGGRAS"
     MSFESLGLAP FLLRALAEQG YETPTPIQQQ AIPLVLAGRD LLAGAQTGTG KTAAFGLPLL        60
     QHLGTASQEV RTGPRKPRAL ILAPTRELAT QVHDSLRGYS KYLRIPSACI YGGVGMGNQL       120
     DILRRGVDLL VACPGRLIDH LERRSIDLSG IELLVLDEAD RMLDMGFLPS IKRILAKLPK       180
     QNRQTLLFSA TFEDNIRQLA LEFMRNPEQI QVTPKNTVAE TITHRVHPVD GGRKRDLLLH       240
     LLAQDSREQT LVFARTKHGS DKLAAFLEKS GIKTAAIHGN KSQGQRLRAL GDFKAGRVTV       300
     LVATDIAARG IDINELPKVI NFDLPMVAED YVHRIGRTGR NGATGQAISL VAQDEVKLLR       360
     AITRLLGRDM DIRDVPGFEL QVPIRWGNSA PGKAEHETGE RAPRKNHARR PHGDAPRHAH       420
     AGPKKAGGGR REGGGNGQQR AGAGAGQGQR RGGAGNGGGR GRGQGGGGRA S                471
//

If you have problems or comments...

PBIL Back to PBIL home page