(data stored in ACNUC7421 zone)

EMBL: CP001111.PE487

CP001111.PE487       Location/Qualifiers
FT   CDS             571743..571979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0487"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   xcb:XC_3637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50192"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII7"
FT                   /protein_id="ACF50192.1"
FT                   /translation="MFEDQPQSEIDARRARDPEFRALHDQHRKLNKKCMDAELGVLPID
FT                   DVTLGRMKREKLLAKQRLLRMYETPLPTTSPAH"
     MFEDQPQSEI DARRARDPEF RALHDQHRKL NKKCMDAELG VLPIDDVTLG RMKREKLLAK        60
     QRLLRMYETP LPTTSPAH                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page