(data stored in ACNUC7421 zone)

EMBL: CP001111.PE488

CP001111.PE488       Location/Qualifiers
FT   CDS             572346..573716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0488"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: CBS domain containing protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: xcb:XC_3636 cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50193"
FT                   /db_xref="GOA:B4SII8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII8"
FT                   /protein_id="ACF50193.1"
FT                   /translation="MPIHSSVLELIGQTPIVKAQRLDTGACELYLKLESANPGGSIKDR
FT                   IGLSMIEAAEKRGDLKPGATLVEGTAGNTGLGLALVAQQKGYKLILVVPDKMSREKIFN
FT                   LKAMGAEVRLTRSDVAKGHPEYYQDLAKTIAEQTPGAYFINQFGNPDNPAAHEFGTGPE
FT                   ILEQMGGDLDAIVFGCGSSGTMTGLSRAFAKLSPKTELVLADPVGSILAEYINDGNLND
FT                   KSGSWLVEGIGEDFLPSISDFSRVKKAYAISDAESFHTARELLGKEGILGGSSTGTLLA
FT                   AALKYCKEQTTPKKVLVLVPDTGNKYLSKMYNDYWMLDNGFLQRPQHGDLRDLILRPYG
FT                   QRDTVVIGPNDLLTTAYQRMKLYDVSQLPVLDGDQLVGIVDESDVLLHVYGDEARFRDP
FT                   VATAMVSKLDRLDVKSPIEALLPVFDRGQVAIVMDGNAFLGLITRIDLLNYLRRRVQ"
     MPIHSSVLEL IGQTPIVKAQ RLDTGACELY LKLESANPGG SIKDRIGLSM IEAAEKRGDL        60
     KPGATLVEGT AGNTGLGLAL VAQQKGYKLI LVVPDKMSRE KIFNLKAMGA EVRLTRSDVA       120
     KGHPEYYQDL AKTIAEQTPG AYFINQFGNP DNPAAHEFGT GPEILEQMGG DLDAIVFGCG       180
     SSGTMTGLSR AFAKLSPKTE LVLADPVGSI LAEYINDGNL NDKSGSWLVE GIGEDFLPSI       240
     SDFSRVKKAY AISDAESFHT ARELLGKEGI LGGSSTGTLL AAALKYCKEQ TTPKKVLVLV       300
     PDTGNKYLSK MYNDYWMLDN GFLQRPQHGD LRDLILRPYG QRDTVVIGPN DLLTTAYQRM       360
     KLYDVSQLPV LDGDQLVGIV DESDVLLHVY GDEARFRDPV ATAMVSKLDR LDVKSPIEAL       420
     LPVFDRGQVA IVMDGNAFLG LITRIDLLNY LRRRVQ                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page