(data stored in ACNUC7421 zone)

EMBL: CP001111.PE489

CP001111.PE489       Location/Qualifiers
FT   CDS             573840..575012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0489"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: xcb:XC_3635
FT                   cystathionine gamma-lyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50194"
FT                   /db_xref="GOA:B4SII9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII9"
FT                   /protein_id="ACF50194.1"
FT                   /translation="MSNATSQDRALALATLAIHGGQSPDPSTGAVMPPIYATSTYAQSS
FT                   PGEHQGFEYSRTHNPTRFAYERCVASLEGGTRGFAFASGMAASSTVIELLDAGSHVVAM
FT                   DDIYGGSFRLFERVRRRTAGLDFSFVDLTDLAAFEASITPKTKMVWIETPTNPMLKIVD
FT                   IAAVAAIAKRHGLIVVVDNTFASPMLQRPLELGADLVLHSATKYLNGHSDMVGGMVVVG
FT                   DNAELAEQMAFLQNSVGGVQGPFDSFLALRGLKTLPLRMKAHCANALALAQWLEKHPAV
FT                   EKVIYPGLASHPQHELAGKQMAGYGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVE
FT                   SLVNHPAVMTHASIPVARREQLGISDALVRLSVGVEDLGDLQVDLGEALK"
     MSNATSQDRA LALATLAIHG GQSPDPSTGA VMPPIYATST YAQSSPGEHQ GFEYSRTHNP        60
     TRFAYERCVA SLEGGTRGFA FASGMAASST VIELLDAGSH VVAMDDIYGG SFRLFERVRR       120
     RTAGLDFSFV DLTDLAAFEA SITPKTKMVW IETPTNPMLK IVDIAAVAAI AKRHGLIVVV       180
     DNTFASPMLQ RPLELGADLV LHSATKYLNG HSDMVGGMVV VGDNAELAEQ MAFLQNSVGG       240
     VQGPFDSFLA LRGLKTLPLR MKAHCANALA LAQWLEKHPA VEKVIYPGLA SHPQHELAGK       300
     QMAGYGGIVS IVLKGGFDAA KRFCEKTELF TLAESLGGVE SLVNHPAVMT HASIPVARRE       360
     QLGISDALVR LSVGVEDLGD LQVDLGEALK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page