(data stored in ACNUC7421 zone)

EMBL: CP001111.PE492

CP001111.PE492       Location/Qualifiers
FT   CDS             576600..578840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0492"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mxa:MXAN_4620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50197"
FT                   /db_xref="GOA:B4SIJ2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ2"
FT                   /protein_id="ACF50197.1"
FT                   /translation="MNTRNRDYWINRSGDLYADQQKVRREAGNSNYARQEAWLVGFLAE
FT                   RSEQLGRPVRVLDFGVGFGRLARLLPQHAFVDYFGFDISPAMVEPLLREPPAELAVDIG
FT                   RRIRVGSSLTEAMQGEQFDMIFTVSVLIHNNREQAADALAQMRALLAPEGRLCFIENRP
FT                   VSISLLANLWHAGCWSHDFAGTLAPDMNVDVEDGILSDHAIYILHEPAAGILRQLRVPG
FT                   AHGFEPITAGDYLLRTLEATTAVARGMEVESAALGDGIAQMRDAVELYRQAEEHARRNL
FT                   DIARQHLGDDVGLLDGVAHLTAAIDALPALAARIGVLGGETSAQHAQSSERIEALHARE
FT                   AALVESLTQQERELEQAQARLEAAQSANQHLQWQQGLREQVRQVLSSRTDEGAMPYLDA
FT                   PVGGSASVGQPAPSVYEFNARRDLRFAQTVVGHERVCHIMHQEWFGIRAACGSLPGHKL
FT                   AVTSTSAPGAGDVEEVARLLAANKVNRLVIHGFSDGMLQWVKGLAAAGFDRIYMVWHGA
FT                   PSMWIHAEERRLFALAYKAVRTGLIRRVSVMRAGSHAALADVAGWQRQLYNMPPAYTGK
FT                   RIPRRATGATVFIPSWNLIHKNIFTNAAAAAATGEVANIWLMADDFALPYRVDKNVKRL
FT                   PKLSQLQMMEAMSQADAVMNASIVDCHPMVELEALAAGTPALRGRLGMDALEDHPYVEI
FT                   TQVADPLSVADVRQTLRRMLAAPVVEMDDMMSSYSRQMVALSFERYSEFMEI"
     MNTRNRDYWI NRSGDLYADQ QKVRREAGNS NYARQEAWLV GFLAERSEQL GRPVRVLDFG        60
     VGFGRLARLL PQHAFVDYFG FDISPAMVEP LLREPPAELA VDIGRRIRVG SSLTEAMQGE       120
     QFDMIFTVSV LIHNNREQAA DALAQMRALL APEGRLCFIE NRPVSISLLA NLWHAGCWSH       180
     DFAGTLAPDM NVDVEDGILS DHAIYILHEP AAGILRQLRV PGAHGFEPIT AGDYLLRTLE       240
     ATTAVARGME VESAALGDGI AQMRDAVELY RQAEEHARRN LDIARQHLGD DVGLLDGVAH       300
     LTAAIDALPA LAARIGVLGG ETSAQHAQSS ERIEALHARE AALVESLTQQ ERELEQAQAR       360
     LEAAQSANQH LQWQQGLREQ VRQVLSSRTD EGAMPYLDAP VGGSASVGQP APSVYEFNAR       420
     RDLRFAQTVV GHERVCHIMH QEWFGIRAAC GSLPGHKLAV TSTSAPGAGD VEEVARLLAA       480
     NKVNRLVIHG FSDGMLQWVK GLAAAGFDRI YMVWHGAPSM WIHAEERRLF ALAYKAVRTG       540
     LIRRVSVMRA GSHAALADVA GWQRQLYNMP PAYTGKRIPR RATGATVFIP SWNLIHKNIF       600
     TNAAAAAATG EVANIWLMAD DFALPYRVDK NVKRLPKLSQ LQMMEAMSQA DAVMNASIVD       660
     CHPMVELEAL AAGTPALRGR LGMDALEDHP YVEITQVADP LSVADVRQTL RRMLAAPVVE       720
     MDDMMSSYSR QMVALSFERY SEFMEI                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page