(data stored in ACNUC7421 zone)

EMBL: CP001111.PE495

CP001111.PE495       Location/Qualifiers
FT   CDS             complement(583105..584115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0495"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: dac:Daci_5547 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50200"
FT                   /db_xref="GOA:B4SIJ5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ5"
FT                   /protein_id="ACF50200.1"
FT                   /translation="MRVLVTGGAGYLGSHVCAELLLGGHEVTVVDDFSNARPDVGERLN
FT                   MLTGRVLNIITGDIRDRAILDRAFLQQRPEAVMHFAALKAVGESAVVPLAYYDVNVAGT
FT                   INLLQCMQRNACHKLVFSSSATVYGNSSHCPINEGAPTSATSPYGRTKLFVEQIINDAK
FT                   LADPLLQAINLRYFNPVGAHESGLLGEEPSGTPNNLMPYIAQVAAGLRSHVSVFGADYA
FT                   TTDGTGIRDYIHVCDLATAHIRTLEALPNLSGLNALNLGTGIPYSVLDVIRAFSEASGR
FT                   PVPYEIVGRRPGDIGECWADPSLAECRLGWSAKLDLAKMCRDTWRWQQILMSRSQ"
     MRVLVTGGAG YLGSHVCAEL LLGGHEVTVV DDFSNARPDV GERLNMLTGR VLNIITGDIR        60
     DRAILDRAFL QQRPEAVMHF AALKAVGESA VVPLAYYDVN VAGTINLLQC MQRNACHKLV       120
     FSSSATVYGN SSHCPINEGA PTSATSPYGR TKLFVEQIIN DAKLADPLLQ AINLRYFNPV       180
     GAHESGLLGE EPSGTPNNLM PYIAQVAAGL RSHVSVFGAD YATTDGTGIR DYIHVCDLAT       240
     AHIRTLEALP NLSGLNALNL GTGIPYSVLD VIRAFSEASG RPVPYEIVGR RPGDIGECWA       300
     DPSLAECRLG WSAKLDLAKM CRDTWRWQQI LMSRSQ                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page