(data stored in ACNUC7421 zone)

EMBL: CP001111.PE496

CP001111.PE496       Location/Qualifiers
FT   CDS             584297..585895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50201"
FT                   /db_xref="GOA:B4SIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ6"
FT                   /protein_id="ACF50201.1"
FT                   /translation="MATPTAPLLRLTLLGVGLVLVLLPGVLLMRELLHVGMQEDAMIGL
FT                   RHLRNMLEGSGFVYNRGESALGATNPLFWIFSFLAIKPFYLASPSLDVLVAHYYFCGFA
FT                   LLAAAIAFAMATPSRTRTVSVAAMALLSVLFFWPLRFLYLGLEGPFMLVCVGVIGLLAV
FT                   RSVGTRDGLLATLVGFLSWNRPEIALILIPAVLFYALLMSDKSSRIRVSVGYLAGAVAF
FT                   PLMLKLVSGAYIVGTVQAKAYFGNPSPPYNLDFFVQRIIYLDSFIGLGGGVTVLLLVGI
FT                   FASAIIGILDFLQGDRKQMPWVRGVYPAFVAGYSCFVLFIPSLWEWYVTFWLSFALVQY
FT                   GVLISRGINCCFSALRGNVGAAVLGVTIVLLSTSWLMGHRLATQRTEIVGWITQDAGFR
FT                   GRLSKELNERWHARSVWMEAAGWQGYFNNARIFDEVGLVDDETQPLAQKYGCAYFVSAL
FT                   KELQPQFVIKRQFEMDRNVMLTPPRSCPNAPLFSNDADRLWFDSNYEAVEHYGTPAPGY
FT                   FGEYSFLVLYRSRNK"
     MATPTAPLLR LTLLGVGLVL VLLPGVLLMR ELLHVGMQED AMIGLRHLRN MLEGSGFVYN        60
     RGESALGATN PLFWIFSFLA IKPFYLASPS LDVLVAHYYF CGFALLAAAI AFAMATPSRT       120
     RTVSVAAMAL LSVLFFWPLR FLYLGLEGPF MLVCVGVIGL LAVRSVGTRD GLLATLVGFL       180
     SWNRPEIALI LIPAVLFYAL LMSDKSSRIR VSVGYLAGAV AFPLMLKLVS GAYIVGTVQA       240
     KAYFGNPSPP YNLDFFVQRI IYLDSFIGLG GGVTVLLLVG IFASAIIGIL DFLQGDRKQM       300
     PWVRGVYPAF VAGYSCFVLF IPSLWEWYVT FWLSFALVQY GVLISRGINC CFSALRGNVG       360
     AAVLGVTIVL LSTSWLMGHR LATQRTEIVG WITQDAGFRG RLSKELNERW HARSVWMEAA       420
     GWQGYFNNAR IFDEVGLVDD ETQPLAQKYG CAYFVSALKE LQPQFVIKRQ FEMDRNVMLT       480
     PPRSCPNAPL FSNDADRLWF DSNYEAVEHY GTPAPGYFGE YSFLVLYRSR NK               532
//

If you have problems or comments...

PBIL Back to PBIL home page