(data stored in ACNUC7421 zone)

EMBL: CP001111.PE499

CP001111.PE499       Location/Qualifiers
FT   CDS             complement(587415..588728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0499"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   xac:XAC3590 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50204"
FT                   /db_xref="GOA:B4SJ36"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ36"
FT                   /protein_id="ACF50204.1"
FT                   /translation="MSAPAGQSWGRYPRVNQRIVPVFDRDVPLPLPVDGGSVLPHGNGR
FT                   SYGDSCLNPDATLLTSHGLDRFIDFDPATGIVRCESGVTLASILDIALPRGWFLPVTPG
FT                   TRYATVGGAIGNDVHGKNHHRAGTFCHHVLRLELLRSDGSRQQLTAADSSGLFAATAGG
FT                   LGLTGFITWAELQLRRVPGPWIETESIRFGNLDEFFELSRDSAAGYEYTVAWIDCLAKG
FT                   RNLGRGHFLRGDHAPGDAQAATPSSAPRRSMPLVPPVSLVNGLTLRPFNTLYYWRQPAH
FT                   RARHVSHYQSYFYPLDGINHWNRMYGPRGFLQHQCVLPPAHARDATAALLAEIARSGRG
FT                   SFLAVLKEFGDIPSPGMLSFPRPGTTLALDFPNDGPGLLTMLERLDRIVSDAGGAVYPA
FT                   KDARMSGALFRQAYPAWEQFSHFIDPRFSSGFWRRVME"
     MSAPAGQSWG RYPRVNQRIV PVFDRDVPLP LPVDGGSVLP HGNGRSYGDS CLNPDATLLT        60
     SHGLDRFIDF DPATGIVRCE SGVTLASILD IALPRGWFLP VTPGTRYATV GGAIGNDVHG       120
     KNHHRAGTFC HHVLRLELLR SDGSRQQLTA ADSSGLFAAT AGGLGLTGFI TWAELQLRRV       180
     PGPWIETESI RFGNLDEFFE LSRDSAAGYE YTVAWIDCLA KGRNLGRGHF LRGDHAPGDA       240
     QAATPSSAPR RSMPLVPPVS LVNGLTLRPF NTLYYWRQPA HRARHVSHYQ SYFYPLDGIN       300
     HWNRMYGPRG FLQHQCVLPP AHARDATAAL LAEIARSGRG SFLAVLKEFG DIPSPGMLSF       360
     PRPGTTLALD FPNDGPGLLT MLERLDRIVS DAGGAVYPAK DARMSGALFR QAYPAWEQFS       420
     HFIDPRFSSG FWRRVME                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page