(data stored in ACNUC7421 zone)

EMBL: CP001111.PE5

CP001111.PE5         Location/Qualifiers
FT   CDS             7655..8500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0005"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: xcb:XC_0005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49710"
FT                   /db_xref="GOA:B4SR09"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR09"
FT                   /protein_id="ACF49710.1"
FT                   /translation="MSASAPVSAPPPVPPASTAPRAGSPLAGFFIDLGIAAVTLFGLSM
FT                   VTGLLWGFYRAIVVGYANAQANGGALSPAETTAAVGQPGALAQILMALIATGGAALLLY
FT                   FWRRPANAAERLASRQALRQPSTWGWTVLVALLIVLGSNGIAFLAKQFGIAPVPTNVEL
FT                   MQNAIARFPLFLVLFAVVLAPAYEELLFRRVLFGRLWQAGRPWLGVILSSLAFALVHEV
FT                   PGVSRNSLLGMAQLWLVYGGMGAAFCWLYQRTGTLWAAITAHALNNAVALAAMVFLGST
FT                   "
     MSASAPVSAP PPVPPASTAP RAGSPLAGFF IDLGIAAVTL FGLSMVTGLL WGFYRAIVVG        60
     YANAQANGGA LSPAETTAAV GQPGALAQIL MALIATGGAA LLLYFWRRPA NAAERLASRQ       120
     ALRQPSTWGW TVLVALLIVL GSNGIAFLAK QFGIAPVPTN VELMQNAIAR FPLFLVLFAV       180
     VLAPAYEELL FRRVLFGRLW QAGRPWLGVI LSSLAFALVH EVPGVSRNSL LGMAQLWLVY       240
     GGMGAAFCWL YQRTGTLWAA ITAHALNNAV ALAAMVFLGS T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page