(data stored in ACNUC7421 zone)

EMBL: CP001111.PE500

CP001111.PE500       Location/Qualifiers
FT   CDS             complement(588725..590143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0500"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: xac:XAC3589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50205"
FT                   /db_xref="GOA:B4SJ37"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ37"
FT                   /protein_id="ACF50205.1"
FT                   /translation="MTASNRPLCVDLDGTLLRSDILYESLLALLAHNPLYVFLVPFWLL
FT                   KGKAYVKRQLASRVQLPAAILPYDERVLEILRTTTQRPRVLCTASDRLLVQPIADHLDL
FT                   FEEVMASDGYTNLSGTNKGQALAERFGERGFDYMGNGQVDLKVWAHAGGAIVVNNGNGL
FT                   VRAASTRTEVLAHLPSQSGGLLTWIKALRVYQWLKNLLVLVPLLTAHRFFDIGSVVDAG
FT                   VAFLAFGLCASGVYLLNDLLDLTPDRMHPRKRRRPFAAGTLPLLHGLLAAPLITLAGFA
FT                   LALACSPAFAGVLLCYYVMTLSYSLKLKRIVMIDVVMLAALYTVRIIGGAVAISSELSF
FT                   WLLAFSMFVFLSLAMLKRYTELASALASGKEVAIGRGYSVADLPLVQSLGAAAGYIGVL
FT                   VFALYINSPESLELYTSPKLLWLLCPILLYWISRMWIVSHRGDMHDDPIVFAATDRSSQ
FT                   IVIGLCLLIVLIAI"
     MTASNRPLCV DLDGTLLRSD ILYESLLALL AHNPLYVFLV PFWLLKGKAY VKRQLASRVQ        60
     LPAAILPYDE RVLEILRTTT QRPRVLCTAS DRLLVQPIAD HLDLFEEVMA SDGYTNLSGT       120
     NKGQALAERF GERGFDYMGN GQVDLKVWAH AGGAIVVNNG NGLVRAASTR TEVLAHLPSQ       180
     SGGLLTWIKA LRVYQWLKNL LVLVPLLTAH RFFDIGSVVD AGVAFLAFGL CASGVYLLND       240
     LLDLTPDRMH PRKRRRPFAA GTLPLLHGLL AAPLITLAGF ALALACSPAF AGVLLCYYVM       300
     TLSYSLKLKR IVMIDVVMLA ALYTVRIIGG AVAISSELSF WLLAFSMFVF LSLAMLKRYT       360
     ELASALASGK EVAIGRGYSV ADLPLVQSLG AAAGYIGVLV FALYINSPES LELYTSPKLL       420
     WLLCPILLYW ISRMWIVSHR GDMHDDPIVF AATDRSSQIV IGLCLLIVLI AI               472
//

If you have problems or comments...

PBIL Back to PBIL home page