(data stored in ACNUC7421 zone)

EMBL: CP001111.PE501

CP001111.PE501       Location/Qualifiers
FT   CDS             complement(590536..591474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0501"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: xcb:XC_3615 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50206"
FT                   /db_xref="GOA:B4SJ38"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ38"
FT                   /protein_id="ACF50206.1"
FT                   /translation="MSRILVIAEHHDGKLNAATAKTVSAATAIAGASIDVLVLAADPAA
FT                   VAAEAAKIAGVAKVLTVANAANAQAIAQVLAPQIAQLAKGYTHLFGPSTTFGKDLMPCV
FT                   AALLGVNQVSDLMSVEGSHTFKRPIYAGNAIITVEAPADQIVVATVRAASWPEAAQGGS
FT                   AAIEAANVDAALPTHTRFVGLAAGASDRPDLQSAKRVVSGGRGVGSEENFKVIFQLADK
FT                   LGAAVGASRAAVDAGYVPSDLQVGQTGKIIAPELYVAVGISGAIQHLTGIKDAGTIVAI
FT                   NKDGDAPIFEIADIGLAGDLFAILPELEKAL"
     MSRILVIAEH HDGKLNAATA KTVSAATAIA GASIDVLVLA ADPAAVAAEA AKIAGVAKVL        60
     TVANAANAQA IAQVLAPQIA QLAKGYTHLF GPSTTFGKDL MPCVAALLGV NQVSDLMSVE       120
     GSHTFKRPIY AGNAIITVEA PADQIVVATV RAASWPEAAQ GGSAAIEAAN VDAALPTHTR       180
     FVGLAAGASD RPDLQSAKRV VSGGRGVGSE ENFKVIFQLA DKLGAAVGAS RAAVDAGYVP       240
     SDLQVGQTGK IIAPELYVAV GISGAIQHLT GIKDAGTIVA INKDGDAPIF EIADIGLAGD       300
     LFAILPELEK AL                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page