(data stored in ACNUC7421 zone)

EMBL: CP001111.PE502

CP001111.PE502       Location/Qualifiers
FT   CDS             complement(591474..592220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0502"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: xac:XAC3586 electron transfer
FT                   flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50207"
FT                   /db_xref="GOA:B4SJ39"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ39"
FT                   /protein_id="ACF50207.1"
FT                   /translation="MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEE
FT                   ALRLRDKGIASEVVVATIAPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTASRTLLKL
FT                   IEKEQPDLVILGKQAIDDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGL
FT                   ETLEVDLPAVVTTDLRLNEPRFIKLPDIMKAKAKPLETLQLADLGVEAADTFKTTQYAA
FT                   PSKRSKGVMVKDAAELVAALKQKGLL"
     MKILVAYKRV VDYNVRIQVK PDGSGVVTDG VKLSPNPFDE IALEEALRLR DKGIASEVVV        60
     ATIAPADAQA HLRNGLAMGA NRAIHVVTDQ AIQPLTASRT LLKLIEKEQP DLVILGKQAI       120
     DDDANQTGQM LATLWGRPQA TFASKLEIAD GKATVTREVD AGLETLEVDL PAVVTTDLRL       180
     NEPRFIKLPD IMKAKAKPLE TLQLADLGVE AADTFKTTQY AAPSKRSKGV MVKDAAELVA       240
     ALKQKGLL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page