(data stored in ACNUC7421 zone)

EMBL: CP001111.PE506

CP001111.PE506       Location/Qualifiers
FT   CDS             595014..595952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0506"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: xac:XAC3582 dTDP-4-keto-L-rhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50211"
FT                   /db_xref="GOA:B4SJ43"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ43"
FT                   /protein_id="ACF50211.1"
FT                   /translation="MTVLVLGGNGQVGQELLRALVPLGKVVTTTRSGILPDGSVCETAD
FT                   FDQPDSLPALLDRLQPSVVVNAAAYTAVDRAEREVDAAFAVNAEAPGVIARWCAAHDVP
FT                   FVHYSTDYVFDGQGTAPYREDEPTAPLGVYGISKRDGEDAVRAAGGRHLIFRTAWVYAS
FT                   HGANFLRTMLRVGAERDALRVVADQIGTPTPAALIADVTAQALQHPGQLSGTWHLTASG
FT                   QTSWYGFAEAIFAEALATGVLAKVPAVEAIPSSEYPTPAKRPAWSVLDNRKLQQDLGTA
FT                   LPDWHEGLAIVMNEIKRLRDESAGGRASWTN"
     MTVLVLGGNG QVGQELLRAL VPLGKVVTTT RSGILPDGSV CETADFDQPD SLPALLDRLQ        60
     PSVVVNAAAY TAVDRAEREV DAAFAVNAEA PGVIARWCAA HDVPFVHYST DYVFDGQGTA       120
     PYREDEPTAP LGVYGISKRD GEDAVRAAGG RHLIFRTAWV YASHGANFLR TMLRVGAERD       180
     ALRVVADQIG TPTPAALIAD VTAQALQHPG QLSGTWHLTA SGQTSWYGFA EAIFAEALAT       240
     GVLAKVPAVE AIPSSEYPTP AKRPAWSVLD NRKLQQDLGT ALPDWHEGLA IVMNEIKRLR       300
     DESAGGRASW TN                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page