(data stored in ACNUC7421 zone)

EMBL: CP001111.PE508

CP001111.PE508       Location/Qualifiers
FT   CDS             complement(598002..599405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0508"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: xcb:XC_3609 phosphomannose
FT                   isomerase/GDP-mannose pyrophosphorylase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50213"
FT                   /db_xref="GOA:B4SJ45"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ45"
FT                   /protein_id="ACF50213.1"
FT                   /translation="MSSIQPVILSGGSGTRLWPLSREAYPKQFLPLAGELTMLQATWQR
FT                   VAPLAAHGPLVIANEEHRFVAAEQLQQVGAEPAAIILEPVGRNTAPAIAVAALEATRDG
FT                   ADALLLVLPSDHVITNEAAFRSAVQAAASAADAGKLVTFGIVPTGPETGYGYIKAADGQ
FT                   GVRAVERFVEKPDLETATGYVSSGQYYWNSGMFLFKASRYLQELERFQPEMLASSRQAW
FT                   QQARRDADFTRLDKDAFTAVPSDSIDYAVMEKTADAVVIPLDAGWNDVGSWTALRDVSQ
FT                   QDGDGNAHQGDVIAIDCRNTYAYAQRLVALVGLDDVIVVETDDAVLVGKADRMQEVKTV
FT                   VAKLKAEGRSEATWHRKVYRPWGAYDSIDNGERFQVKRITVKPGGTLSLQMHHHRAEHW
FT                   IVVSGTAEVTRGSEVILLSENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIV
FT                   RFEDTYGRS"
     MSSIQPVILS GGSGTRLWPL SREAYPKQFL PLAGELTMLQ ATWQRVAPLA AHGPLVIANE        60
     EHRFVAAEQL QQVGAEPAAI ILEPVGRNTA PAIAVAALEA TRDGADALLL VLPSDHVITN       120
     EAAFRSAVQA AASAADAGKL VTFGIVPTGP ETGYGYIKAA DGQGVRAVER FVEKPDLETA       180
     TGYVSSGQYY WNSGMFLFKA SRYLQELERF QPEMLASSRQ AWQQARRDAD FTRLDKDAFT       240
     AVPSDSIDYA VMEKTADAVV IPLDAGWNDV GSWTALRDVS QQDGDGNAHQ GDVIAIDCRN       300
     TYAYAQRLVA LVGLDDVIVV ETDDAVLVGK ADRMQEVKTV VAKLKAEGRS EATWHRKVYR       360
     PWGAYDSIDN GERFQVKRIT VKPGGTLSLQ MHHHRAEHWI VVSGTAEVTR GSEVILLSEN       420
     QSTYIPLGVT HRLRNPGKLP LELIEVQSGS YLGEDDIVRF EDTYGRS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page