(data stored in ACNUC7421 zone)

EMBL: CP001111.PE509

CP001111.PE509       Location/Qualifiers
FT   CDS             complement(599417..600763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0509"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcb:XC_3608 phosphoglucomutase;
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50214"
FT                   /db_xref="GOA:B4SJ46"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ46"
FT                   /protein_id="ACF50214.1"
FT                   /translation="MPLPAFKAYDIRGRVPEELNEDLARRIGVALAAQLAPGPVVLGHD
FT                   VRLTSAGLQDALAAGLRGTGREVIDIGLCGTEEVYFQTDHLGAAGGVMVTASHNPMDYN
FT                   GMKLVKENARPISSDTGLFAISDAVAGDTSEAQPPRAGQVAQHDKSAYIQHLLSYVDTS
FT                   RLKPLKLVVNAGNGGAGAIVDLLAPHLPFEFIRICHEPDGSFPNGIPNPLLPENRAATA
FT                   DAVREHGADFGIAWDGDFDRCFFFDHSGRFIEGYYLVGLLAKAILARNPGGKIVHDPRL
FT                   VWNTVDMVEQAGGVPVQCKSGHAFIKEKMRAEDAVYGGEMSAHHYFREFAYADSGMIPW
FT                   LLIAQLVSESGRSLADWVEDRMAAYPCSGEINFKVDDAKAAVARVMEHFAAQSPALDHT
FT                   DGISADFGDWRFNLRSSNTEPLLRLNVEARGDAALMQARTDEISRLIQQ"
     MPLPAFKAYD IRGRVPEELN EDLARRIGVA LAAQLAPGPV VLGHDVRLTS AGLQDALAAG        60
     LRGTGREVID IGLCGTEEVY FQTDHLGAAG GVMVTASHNP MDYNGMKLVK ENARPISSDT       120
     GLFAISDAVA GDTSEAQPPR AGQVAQHDKS AYIQHLLSYV DTSRLKPLKL VVNAGNGGAG       180
     AIVDLLAPHL PFEFIRICHE PDGSFPNGIP NPLLPENRAA TADAVREHGA DFGIAWDGDF       240
     DRCFFFDHSG RFIEGYYLVG LLAKAILARN PGGKIVHDPR LVWNTVDMVE QAGGVPVQCK       300
     SGHAFIKEKM RAEDAVYGGE MSAHHYFREF AYADSGMIPW LLIAQLVSES GRSLADWVED       360
     RMAAYPCSGE INFKVDDAKA AVARVMEHFA AQSPALDHTD GISADFGDWR FNLRSSNTEP       420
     LLRLNVEARG DAALMQARTD EISRLIQQ                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page