(data stored in ACNUC7421 zone)

EMBL: CP001111.PE510

CP001111.PE510       Location/Qualifiers
FT   CDS             600995..601951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0510"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: xfa:XF0611 dTDP-glucose 4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50215"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ47"
FT                   /protein_id="ACF50215.1"
FT                   /translation="MKFTHDQKRVLVTGGAGFLGSHLCDRLIAAGHDVLCVDNFYTGSK
FT                   ANVDGLLGHPRFELMRHDVTFPLYVEVDRIFNLACPASPIHYQQDPVQTTKTSVHGAIN
FT                   MLGLAKRLRARILQASTSEVYGDPEIHPQVEGYWGRVNPIGIRSCYDEGKRCAETLFFD
FT                   YWRQHQLEIKVMRIFNTYGPRMHPNDGRVVSNFIVQALKGDPITIYGDGSQTRSFCYVD
FT                   DLIEGMLRLMDSPADLTGPINIGNPAEYTMLELAETVLRLVGGSSKIEYRPLPSDDPRQ
FT                   RQPDISLARADLGWEPRVGLEDGLKETIAYFRHRLQA"
     MKFTHDQKRV LVTGGAGFLG SHLCDRLIAA GHDVLCVDNF YTGSKANVDG LLGHPRFELM        60
     RHDVTFPLYV EVDRIFNLAC PASPIHYQQD PVQTTKTSVH GAINMLGLAK RLRARILQAS       120
     TSEVYGDPEI HPQVEGYWGR VNPIGIRSCY DEGKRCAETL FFDYWRQHQL EIKVMRIFNT       180
     YGPRMHPNDG RVVSNFIVQA LKGDPITIYG DGSQTRSFCY VDDLIEGMLR LMDSPADLTG       240
     PINIGNPAEY TMLELAETVL RLVGGSSKIE YRPLPSDDPR QRQPDISLAR ADLGWEPRVG       300
     LEDGLKETIA YFRHRLQA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page