(data stored in ACNUC7421 zone)

EMBL: CP001111.PE512

CP001111.PE512       Location/Qualifiers
FT   CDS             602884..603288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0512"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: xfn:XfasM23_1626
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50217"
FT                   /db_xref="GOA:B4SJ49"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ49"
FT                   /protein_id="ACF50217.1"
FT                   /translation="MPPVVARKDALAGQFIRYVINGLAATAVHYGVLRFNIEVLHIPLA
FT                   AAANALAAVFGIIASFLGSRYFVFRGRQGNVARQGSLFLLVYAGIALLHGLVMYVWADR
FT                   LQLDYRIGFVLATGMQMTISFAANKFLVFK"
     MPPVVARKDA LAGQFIRYVI NGLAATAVHY GVLRFNIEVL HIPLAAAANA LAAVFGIIAS        60
     FLGSRYFVFR GRQGNVARQG SLFLLVYAGI ALLHGLVMYV WADRLQLDYR IGFVLATGMQ       120
     MTISFAANKF LVFK                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page