(data stored in ACNUC7421 zone)

EMBL: CP001111.PE513

CP001111.PE513       Location/Qualifiers
FT   CDS             603285..603884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfm:Xfasm12_1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50218"
FT                   /db_xref="GOA:B4SJ50"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ50"
FT                   /protein_id="ACF50218.1"
FT                   /translation="MNRYLRAVLATVIFVVALLLVYYVHMRHFRVNVVLYASILDAVIA
FT                   LVVVFAGLYLLKWFRDFSRLELIQLAAIWLLGGYVFAISVPTVIDRSLSFYILEKLQQR
FT                   GGGIREDAFHEVFTEEYVREHHLVEVRLTEQLQSGTVQIDGGCVRLTARGERLASFSRF
FT                   YRKNLLPTHRLLMGQYTDALTDPFRDSRMPTDYRCQ"
     MNRYLRAVLA TVIFVVALLL VYYVHMRHFR VNVVLYASIL DAVIALVVVF AGLYLLKWFR        60
     DFSRLELIQL AAIWLLGGYV FAISVPTVID RSLSFYILEK LQQRGGGIRE DAFHEVFTEE       120
     YVREHHLVEV RLTEQLQSGT VQIDGGCVRL TARGERLASF SRFYRKNLLP THRLLMGQYT       180
     DALTDPFRDS RMPTDYRCQ                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page