(data stored in ACNUC7421 zone)

EMBL: CP001111.PE514

CP001111.PE514       Location/Qualifiers
FT   CDS             603934..604359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50219"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ51"
FT                   /protein_id="ACF50219.1"
FT                   /translation="MEDMSNLSVRRRPSPWQWAVAALLGVLLVLALASVARRSHFETPL
FT                   LRQALAEDAGFAASVPREVVDARELMRAQREDLSPLSLGQGLKDDPLLQQRMWEALYPA
FT                   RFSDADTPHRLLKADDPLAATCQVLDRRGNVVLANCR"
     MEDMSNLSVR RRPSPWQWAV AALLGVLLVL ALASVARRSH FETPLLRQAL AEDAGFAASV        60
     PREVVDAREL MRAQREDLSP LSLGQGLKDD PLLQQRMWEA LYPARFSDAD TPHRLLKADD       120
     PLAATCQVLD RRGNVVLANC R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page