(data stored in ACNUC7421 zone)

EMBL: CP001111.PE515

CP001111.PE515       Location/Qualifiers
FT   CDS             604334..605536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50220"
FT                   /db_xref="GOA:B4SJ52"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ52"
FT                   /protein_id="ACF50220.1"
FT                   /translation="MSFLPTAVELGRRAALAMLASLLLCYALAATGLMGWPVLVAFAIF
FT                   LVSALLALPAVRDLRVSPLVLVACALVLIALGSPSDGWDPRSIWLFHAKRIFLEGSLYA
FT                   QLDDYAPWSHNDYPALVPLLMASAAGLLGHWNELLPKAVAPLLLLPALLLIAPSLRSRW
FT                   LVALFALLLLSTGREMLLNGYMDALVAVYAVAVVATAVRARTTGGRPRAGELIAFVLLV
FT                   AVLSMLKNEGAVLAAVLTASVLVDGLLRERRLAWHIVLAVLVALLPLLAWKLSVDGAGV
FT                   GNDLAGSDMKGQLLARLGSDGGSQLILKRLLLDAWVLVPLLLLAVFWRRTLRTPVAMTS
FT                   LLAALAYAAVLFLVYLGTPHDLDWHLRTSADRVRLPVLLLLAFAMLSVLGPRATPVARA
FT                   E"
     MSFLPTAVEL GRRAALAMLA SLLLCYALAA TGLMGWPVLV AFAIFLVSAL LALPAVRDLR        60
     VSPLVLVACA LVLIALGSPS DGWDPRSIWL FHAKRIFLEG SLYAQLDDYA PWSHNDYPAL       120
     VPLLMASAAG LLGHWNELLP KAVAPLLLLP ALLLIAPSLR SRWLVALFAL LLLSTGREML       180
     LNGYMDALVA VYAVAVVATA VRARTTGGRP RAGELIAFVL LVAVLSMLKN EGAVLAAVLT       240
     ASVLVDGLLR ERRLAWHIVL AVLVALLPLL AWKLSVDGAG VGNDLAGSDM KGQLLARLGS       300
     DGGSQLILKR LLLDAWVLVP LLLLAVFWRR TLRTPVAMTS LLAALAYAAV LFLVYLGTPH       360
     DLDWHLRTSA DRVRLPVLLL LAFAMLSVLG PRATPVARAE                             400
//

If you have problems or comments...

PBIL Back to PBIL home page