(data stored in ACNUC7421 zone)

EMBL: CP001111.PE516

CP001111.PE516       Location/Qualifiers
FT   CDS             complement(605567..608881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0516"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bxe:Bxe_B1664 putative helicase; PFAM:
FT                   SNF2-related protein; helicase domain protein; zinc finger
FT                   SWIM domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50221"
FT                   /db_xref="GOA:B4SJ53"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ53"
FT                   /protein_id="ACF50221.1"
FT                   /translation="MTPTFTDEDLFRWIDEWTLQKSEQCLGGVRNRQLRDGLLTAEVQG
FT                   SARHPYYVEIDLTASTRTARSRLQSACSCPVGRTCKHVAAVLVSYMLDSLAMDDESPLT
FT                   EQNLTQPPRPELLAELSRWQSARIQPAQPRRNGVIFELSTYNHHPAVLVRRVKYGTDGA
FT                   ISTGKWMDITADLLLDPPAYLTPTDLAVMIQLRTQRQPATKDEWIDFAATLQLIVSSGH
FT                   GWVSCGTHGDVPARSGAPRRGELGWTVGMTQGATLLEPALSVEGGARGVVLGRSACYLD
FT                   PVTGEVGPLLLDVRAEDADAFLSLPNLLPNEEAVVAQMLQQIDPALPRPGASDTLPTLQ
FT                   ISAMIPVLRLHTIEFRPAWLGRRDPSQWADIATVAFEYDEHVRFLDDPSLFAHDTEGRL
FT                   ALLPRDLAEEARREGELRSVKLHRDPQPRAVLDGAGPQFQLRTHDWTGFLLGDVPRLEA
FT                   LGWKVETDDDFRHRITRVDEIDLDIQADPEDAGWFNLGLEIQVDGRKVSMVPLLQQVLH
FT                   ADPRWSRGQLDAIGDDENILLTASGNTRLALQASRLKPIMALLADLFTQRGAPLRLSAH
FT                   DRGRLQALQDDAHLQFRGHKDTQALVQRLLQAPAPEDVAPPAGLQATLRSYQREGLSWL
FT                   QYLRQQGLGGVLADDMGLGKTLQTLAHLLVEKESGRLDRPALLVVPTSLLHNWQSEAAR
FT                   FTPGLRVLTLHGPAREALFEAIPEHDLVLTTYPLLWRDEQALQSHSYHLLILDEAQQVK
FT                   NPKSRAAVTLRTLQARHRLCLTGTPLENHLGELWTQFDFLLPGLLGSEKLFNQHWRHPI
FT                   ERGSDQRRAQLLAQRLRPFILRRRKDQVAAELPPKTLITRAVTMEGGQRDLYETVRAAM
FT                   EKQVREAISDSGLARSHIRVLDALLKLRQVCCDPRLLPGETPARNAGSAKLELLREMLP
FT                   SMVEEGRRILLFSQFTGMLALIAQALDGLGLAYVTLTGDTQDRVTPVQRFMQGEVPLFL
FT                   ISLKAGGVGLNLTAADTVIHFDPWWNPAAENQASDRAHRIGQQQPVFVYRLIAAGSIEE
FT                   RIAELQERKAMLAESILEGGGSAGPRFSEEDVQALLAPLPGALPARRKAGRQSKVR"
     MTPTFTDEDL FRWIDEWTLQ KSEQCLGGVR NRQLRDGLLT AEVQGSARHP YYVEIDLTAS        60
     TRTARSRLQS ACSCPVGRTC KHVAAVLVSY MLDSLAMDDE SPLTEQNLTQ PPRPELLAEL       120
     SRWQSARIQP AQPRRNGVIF ELSTYNHHPA VLVRRVKYGT DGAISTGKWM DITADLLLDP       180
     PAYLTPTDLA VMIQLRTQRQ PATKDEWIDF AATLQLIVSS GHGWVSCGTH GDVPARSGAP       240
     RRGELGWTVG MTQGATLLEP ALSVEGGARG VVLGRSACYL DPVTGEVGPL LLDVRAEDAD       300
     AFLSLPNLLP NEEAVVAQML QQIDPALPRP GASDTLPTLQ ISAMIPVLRL HTIEFRPAWL       360
     GRRDPSQWAD IATVAFEYDE HVRFLDDPSL FAHDTEGRLA LLPRDLAEEA RREGELRSVK       420
     LHRDPQPRAV LDGAGPQFQL RTHDWTGFLL GDVPRLEALG WKVETDDDFR HRITRVDEID       480
     LDIQADPEDA GWFNLGLEIQ VDGRKVSMVP LLQQVLHADP RWSRGQLDAI GDDENILLTA       540
     SGNTRLALQA SRLKPIMALL ADLFTQRGAP LRLSAHDRGR LQALQDDAHL QFRGHKDTQA       600
     LVQRLLQAPA PEDVAPPAGL QATLRSYQRE GLSWLQYLRQ QGLGGVLADD MGLGKTLQTL       660
     AHLLVEKESG RLDRPALLVV PTSLLHNWQS EAARFTPGLR VLTLHGPARE ALFEAIPEHD       720
     LVLTTYPLLW RDEQALQSHS YHLLILDEAQ QVKNPKSRAA VTLRTLQARH RLCLTGTPLE       780
     NHLGELWTQF DFLLPGLLGS EKLFNQHWRH PIERGSDQRR AQLLAQRLRP FILRRRKDQV       840
     AAELPPKTLI TRAVTMEGGQ RDLYETVRAA MEKQVREAIS DSGLARSHIR VLDALLKLRQ       900
     VCCDPRLLPG ETPARNAGSA KLELLREMLP SMVEEGRRIL LFSQFTGMLA LIAQALDGLG       960
     LAYVTLTGDT QDRVTPVQRF MQGEVPLFLI SLKAGGVGLN LTAADTVIHF DPWWNPAAEN      1020
     QASDRAHRIG QQQPVFVYRL IAAGSIEERI AELQERKAML AESILEGGGS AGPRFSEEDV      1080
     QALLAPLPGA LPARRKAGRQ SKVR                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page