(data stored in ACNUC7421 zone)

EMBL: CP001111.PE518

CP001111.PE518       Location/Qualifiers
FT   CDS             609775..610407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0518"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: xcb:XC_3606 IpsJ protein; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, B subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50223"
FT                   /db_xref="GOA:B4SJ55"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ55"
FT                   /protein_id="ACF50223.1"
FT                   /translation="MAWTRDEMAARAARELTDGAYVNLGIGLPTLVANHIPEGVDVWLQ
FT                   SENGLLGIGPFPTDAEVDADLINAGKQTVTARAGASYFGSHDSFAMIRGGHVNLAILGA
FT                   MQVTHKGDLANWMVPGKMVKGMGGAMDLVAGVQRVVVLMEHTAKNGEHKILAECTLPLT
FT                   GVGVVDRIITDLAVFDVTDKGLLLVEAAPGVSDDELKEKTGVAFVRA"
     MAWTRDEMAA RAARELTDGA YVNLGIGLPT LVANHIPEGV DVWLQSENGL LGIGPFPTDA        60
     EVDADLINAG KQTVTARAGA SYFGSHDSFA MIRGGHVNLA ILGAMQVTHK GDLANWMVPG       120
     KMVKGMGGAM DLVAGVQRVV VLMEHTAKNG EHKILAECTL PLTGVGVVDR IITDLAVFDV       180
     TDKGLLLVEA APGVSDDELK EKTGVAFVRA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page