(data stored in ACNUC7421 zone)

EMBL: CP001111.PE519

CP001111.PE519       Location/Qualifiers
FT   CDS             complement(610418..612478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50224"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ56"
FT                   /protein_id="ACF50224.1"
FT                   /translation="MSGAASGIRQLSFSVLRALFRALPMPAALRDRLRNQGLDRIGSWS
FT                   PPPPRGRVGAAADGARALLRADERAIGYAAAEDAPLPAAPPATLVAFYLPQFHPFEEND
FT                   AWWGKGFTEWRNVSRALPQFEGHVQPRLPGDLGFYDLRVGETLRAQAKLATDHGIGAFC
FT                   FYFYWFSGHTLMEQPLRQWLADSTIELPFCLCWANENWTRRWDGRNQDVLIGQQHSEQD
FT                   DLAFIAHIAEYLRDRRALKVDGHPVLLLYRPQLLPDPKATAARWRGWCRDNGIGEIHLA
FT                   YVQSFERPDPRDIGFDAAVEFPPNIAAPRQLNTSQFLLNPGYEGDVRDWRELAAQMRTA
FT                   PLPDYPLYPGVNPGWDNEARRPGRGRVLLHASPRGYADWLHDTVHGRLRDVPPARRMVF
FT                   INAWNEWAESAVLEPDARLGHAWLQATRRAMTPSQPAPSRPCVVIHAWHLDALPELLSA
FT                   VKDSGLPARLVITTTSDRQAQVQSITESHGLPAEIWAYDNHGRDILPFLHAADRLLQQN
FT                   ESLVLKLHTKRSTHRDNGDQWRREMVDALLGPAQAAANLAHLQADPRLGLMAPAGHLLN
FT                   VADYIGGNAQRMERLWAQLGLDGAPGDGQFASGSMFWVRLQALRPLLDAHLLPSMFEVE
FT                   AGQIDGTLAHAIERATGAVATCAGFSVGDTSQVHGAPPQPASAGYPYARGG"
     MSGAASGIRQ LSFSVLRALF RALPMPAALR DRLRNQGLDR IGSWSPPPPR GRVGAAADGA        60
     RALLRADERA IGYAAAEDAP LPAAPPATLV AFYLPQFHPF EENDAWWGKG FTEWRNVSRA       120
     LPQFEGHVQP RLPGDLGFYD LRVGETLRAQ AKLATDHGIG AFCFYFYWFS GHTLMEQPLR       180
     QWLADSTIEL PFCLCWANEN WTRRWDGRNQ DVLIGQQHSE QDDLAFIAHI AEYLRDRRAL       240
     KVDGHPVLLL YRPQLLPDPK ATAARWRGWC RDNGIGEIHL AYVQSFERPD PRDIGFDAAV       300
     EFPPNIAAPR QLNTSQFLLN PGYEGDVRDW RELAAQMRTA PLPDYPLYPG VNPGWDNEAR       360
     RPGRGRVLLH ASPRGYADWL HDTVHGRLRD VPPARRMVFI NAWNEWAESA VLEPDARLGH       420
     AWLQATRRAM TPSQPAPSRP CVVIHAWHLD ALPELLSAVK DSGLPARLVI TTTSDRQAQV       480
     QSITESHGLP AEIWAYDNHG RDILPFLHAA DRLLQQNESL VLKLHTKRST HRDNGDQWRR       540
     EMVDALLGPA QAAANLAHLQ ADPRLGLMAP AGHLLNVADY IGGNAQRMER LWAQLGLDGA       600
     PGDGQFASGS MFWVRLQALR PLLDAHLLPS MFEVEAGQID GTLAHAIERA TGAVATCAGF       660
     SVGDTSQVHG APPQPASAGY PYARGG                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page