(data stored in ACNUC7421 zone)

EMBL: CP001111.PE527

CP001111.PE527       Location/Qualifiers
FT   CDS             complement(618861..620564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0527"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: xac:XAC3567 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Anticodon-binding domain protein;
FT                   YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50232"
FT                   /db_xref="GOA:B4SJ64"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ64"
FT                   /protein_id="ACF50232.1"
FT                   /translation="MRLSQFHLHTTKETPSDAELTSHRLMLRAGMIRKLASGLYTWSPL
FT                   GLRVLRKVERIVREEMDRAGAVEFQIPTIQPKELWEQTGRWQKFGPQLLKIKDRKDQTF
FT                   CYSPTAEEAACDFARSELSSYKQLPVNFYQIQTKFRDEIRPRFGVMRSREFLMKDAYSF
FT                   HLHDECLVREYENMKSAYSRIFTRLGLDFRMVQADSGAIGGDASQEFHVIADSGEDALV
FT                   FSTGSDYAANMEAAIAADPAPRAAASEAMRKVDTPTQKTCEDVAALLGINLQRTVKSVA
FT                   LIAGEGEAQQFVLVLVRGDHEVNEIKLAKVAGLDEQRFASEAEIAEHLGSVPGFLGPIA
FT                   PAKAIRVVADREVAAMSDFVVGANEAGFHLAGVNWGRDLAEPEVADIRNVRAGDRALDG
FT                   GELKIARGIEVGHVFQLGRTYARALDATVLDENGKAAVMAMGCYGIGISRVVAAAIEQN
FT                   HDDAGIIWPDAMAPWQVVVCVINPKGDAAVADAATNLLQELRDAGLDAALDDRGLRPGA
FT                   MFADMELIGIPHRVVVSERGLAAGTYEYRSRRASEAESLDKATLLQRLQG"
     MRLSQFHLHT TKETPSDAEL TSHRLMLRAG MIRKLASGLY TWSPLGLRVL RKVERIVREE        60
     MDRAGAVEFQ IPTIQPKELW EQTGRWQKFG PQLLKIKDRK DQTFCYSPTA EEAACDFARS       120
     ELSSYKQLPV NFYQIQTKFR DEIRPRFGVM RSREFLMKDA YSFHLHDECL VREYENMKSA       180
     YSRIFTRLGL DFRMVQADSG AIGGDASQEF HVIADSGEDA LVFSTGSDYA ANMEAAIAAD       240
     PAPRAAASEA MRKVDTPTQK TCEDVAALLG INLQRTVKSV ALIAGEGEAQ QFVLVLVRGD       300
     HEVNEIKLAK VAGLDEQRFA SEAEIAEHLG SVPGFLGPIA PAKAIRVVAD REVAAMSDFV       360
     VGANEAGFHL AGVNWGRDLA EPEVADIRNV RAGDRALDGG ELKIARGIEV GHVFQLGRTY       420
     ARALDATVLD ENGKAAVMAM GCYGIGISRV VAAAIEQNHD DAGIIWPDAM APWQVVVCVI       480
     NPKGDAAVAD AATNLLQELR DAGLDAALDD RGLRPGAMFA DMELIGIPHR VVVSERGLAA       540
     GTYEYRSRRA SEAESLDKAT LLQRLQG                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page