(data stored in ACNUC7421 zone)

EMBL: CP001111.PE528

CP001111.PE528       Location/Qualifiers
FT   CDS             complement(621158..621532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfn:XfasM23_1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50233"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ65"
FT                   /protein_id="ACF50233.1"
FT                   /translation="MRALSCLGCLLLLASANAVAGPVYKWKDANGVTQYSETPPAGKKF
FT                   ETREQARSPQAAASAETPAAPVPEQCSTARANLALLDSTGTVMQDTNGDGKADTALTQE
FT                   QRSAQKGLAEAAIKAYCPAE"
     MRALSCLGCL LLLASANAVA GPVYKWKDAN GVTQYSETPP AGKKFETREQ ARSPQAAASA        60
     ETPAAPVPEQ CSTARANLAL LDSTGTVMQD TNGDGKADTA LTQEQRSAQK GLAEAAIKAY       120
     CPAE                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page