(data stored in ACNUC7421 zone)

EMBL: CP001111.PE530

CP001111.PE530       Location/Qualifiers
FT   CDS             622386..622889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50235"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ67"
FT                   /protein_id="ACF50235.1"
FT                   /translation="MSQDLPVLWSSAQQAWLQAMGYTVYHDGQLAAELDAALQLSVAEA
FT                   EAAQPAEPARASSPIAREHPAEAVPAPRAERPAPPRRETPVSAPDTAPAPARPLPSGNA
FT                   RQPVVRLPDRLQIALLRASGCNPNDPATQTLMESWPLDQLRHDPAAKRALWPQLRALRK
FT                   RGMP"
     MSQDLPVLWS SAQQAWLQAM GYTVYHDGQL AAELDAALQL SVAEAEAAQP AEPARASSPI        60
     AREHPAEAVP APRAERPAPP RRETPVSAPD TAPAPARPLP SGNARQPVVR LPDRLQIALL       120
     RASGCNPNDP ATQTLMESWP LDQLRHDPAA KRALWPQLRA LRKRGMP                     167
//

If you have problems or comments...

PBIL Back to PBIL home page