(data stored in ACNUC7421 zone)

EMBL: CP001111.PE534

CP001111.PE534       Location/Qualifiers
FT   CDS             complement(627228..627419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_A2104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50239"
FT                   /db_xref="GOA:B4SJ71"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ71"
FT                   /protein_id="ACF50239.1"
FT                   /translation="MRLLIALILPWLSFFTIGRPFAGIVCLILQITLIGWLPAAIWAAY
FT                   AVSQYHTDQKIRRALGPR"
     MRLLIALILP WLSFFTIGRP FAGIVCLILQ ITLIGWLPAA IWAAYAVSQY HTDQKIRRAL        60
     GPR                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page