(data stored in ACNUC7421 zone)

EMBL: CP001111.PE538

CP001111.PE538       Location/Qualifiers
FT   CDS             630609..631715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0538"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   xcb:XC_3583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50243"
FT                   /db_xref="GOA:B4SJ75"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ75"
FT                   /protein_id="ACF50243.1"
FT                   /translation="MRLRPMRFDLYLGQSVFTTVLLTWTVLVGLDVVMAFSGEFKDIGK
FT                   NGYSLGHAAAWVLYTVPRRAYTFFPTAAVIGALMGLGQLAATSELTALRALGLSRKRLS
FT                   VSVAIALSLLTAVMVLSAETLGPWGQDRADALKSSAKWGQDISTARYSGLWAREGDTFL
FT                   SAAGGEEQLVGDKGTRLILRDVRLYRIAEDGQIASLTHAATAEHDNDGWVLTGVRRDTF
FT                   GERSATREEVAREPWNSKLDAGALATGIAKPRNLSVAELRTSIEYRERNGLDARDYEDV
FT                   YWSRWFYPVNVLALCLAAVPFAFGSLRSGGMGKRLFLGILFALGFWLLQLFFGRMAGAL
FT                   KFDYRIAYALPPIVMLAISGLLFRRKSG"
     MRLRPMRFDL YLGQSVFTTV LLTWTVLVGL DVVMAFSGEF KDIGKNGYSL GHAAAWVLYT        60
     VPRRAYTFFP TAAVIGALMG LGQLAATSEL TALRALGLSR KRLSVSVAIA LSLLTAVMVL       120
     SAETLGPWGQ DRADALKSSA KWGQDISTAR YSGLWAREGD TFLSAAGGEE QLVGDKGTRL       180
     ILRDVRLYRI AEDGQIASLT HAATAEHDND GWVLTGVRRD TFGERSATRE EVAREPWNSK       240
     LDAGALATGI AKPRNLSVAE LRTSIEYRER NGLDARDYED VYWSRWFYPV NVLALCLAAV       300
     PFAFGSLRSG GMGKRLFLGI LFALGFWLLQ LFFGRMAGAL KFDYRIAYAL PPIVMLAISG       360
     LLFRRKSG                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page