(data stored in ACNUC7421 zone)

EMBL: CP001111.PE539

CP001111.PE539       Location/Qualifiers
FT   CDS             complement(631798..632289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0539"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   xom:XOO_0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50244"
FT                   /db_xref="GOA:B4SJ76"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ76"
FT                   /protein_id="ACF50244.1"
FT                   /translation="MSRPATDTATAATTEMPRPRALLLWRTLAMVYDTLPVLALWMLAG
FT                   TLFTIAYTLDGHTQRENIAPFSAWQWLLWAVCWAITGWYATASWRRGGQTLGMRPWRLK
FT                   LESSDGTPLRRRQLWLRFAVGTLSLLLGGIGFWWALIDRQRLTWHDRASGTRLVRMPKR
FT                   "
     MSRPATDTAT AATTEMPRPR ALLLWRTLAM VYDTLPVLAL WMLAGTLFTI AYTLDGHTQR        60
     ENIAPFSAWQ WLLWAVCWAI TGWYATASWR RGGQTLGMRP WRLKLESSDG TPLRRRQLWL       120
     RFAVGTLSLL LGGIGFWWAL IDRQRLTWHD RASGTRLVRM PKR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page