(data stored in ACNUC7421 zone)

EMBL: CP001111.PE541

CP001111.PE541       Location/Qualifiers
FT   CDS             633424..634215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0541"
FT                   /product="protein disulfide isomerase precursor"
FT                   /note="KEGG: xcv:XCV3675 protein disulfide isomerase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50246"
FT                   /db_xref="GOA:B4SJ78"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ78"
FT                   /protein_id="ACF50246.1"
FT                   /translation="MLRFAIAAVFGALSLTACAQPAPPAAKAPATAAAAKAASPAANGS
FT                   ADQAVRAALTALNPGFEVDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAK
FT                   GPANSEGLLGYRRDLLAKANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNR
FT                   NGISVEYLAFPRMGLGSKDYTDMISVWCAADRRQALTSAKRGGSVPAKSCTNPVAMQYA
FT                   LGQQLGVNGTPAIFAPDGTQLGGYLPPAQLRAALEKLSAKR"
     MLRFAIAAVF GALSLTACAQ PAPPAAKAPA TAAAAKAASP AANGSADQAV RAALTALNPG        60
     FEVDYIGAAP FPGFREVVVS GQLLYVSDDG RYLFQSQPYD TRAKGPANSE GLLGYRRDLL       120
     AKANHGDRIV FAAPNAKYTI SVFTDIECGY CRKLHQDIAE LNRNGISVEY LAFPRMGLGS       180
     KDYTDMISVW CAADRRQALT SAKRGGSVPA KSCTNPVAMQ YALGQQLGVN GTPAIFAPDG       240
     TQLGGYLPPA QLRAALEKLS AKR                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page