(data stored in ACNUC7421 zone)

EMBL: CP001111.PE545

CP001111.PE545       Location/Qualifiers
FT   CDS             648940..650793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0545"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: xcv:XCV3669
FT                   extracellular serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50250"
FT                   /db_xref="GOA:B4SJ82"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ82"
FT                   /protein_id="ACF50250.1"
FT                   /translation="MIKKQNLRINVLAAAVLSMTAVGAVHAAGLPTREPVRQASTAQPG
FT                   AERIIVKYRAGAAAATDRSAKLSSVQSALTRASLSGGTSRASTLGPQVVRKLATGADLI
FT                   RVQGRLAPAELQRVLKELQADPSVQYAEADVKLRRTELRAGDVQPALVPNDPFYQQNQW
FT                   HLHNAVGGINAPAAWDVSQGEGIVVAVIDTGILPQHPDLVGNLLEGYDFISDAETSRRP
FT                   TNDRVPGALDQGDWVENDNECYDGSLAEDSSWHGTHVAGTVAEQTNNGVGMAGVAYKAK
FT                   VLPVRVLGKCGGYLSDIADAVVWASGGTVTGIPANTNPAEIINMSLGGSGACGSTYQDA
FT                   INGAISRGTTVVVAAGNETDNASKYRPASCEGVVTVGATRITGGITYYSNYGTRVDLSG
FT                   PGGGGSVDGNPGGYIWQTGSNAATTPDSGTPGYMGMGGTSMASPHVAAVAALVQSALIA
FT                   KGKDPLTPAAMRTLLKETARPFPVAIPAATPIGTGILDAKAALAKALEEPCTENCGPVA
FT                   TPLTNKAAIGGLSGAAGSSKLYSFEAAAGKQFSVITYGGTGNVSVYVAEGREPSASDND
FT                   AKSTRPGTSETVRVTKPVAATYYIKVVGEAAYNGVSILATQ"
     MIKKQNLRIN VLAAAVLSMT AVGAVHAAGL PTREPVRQAS TAQPGAERII VKYRAGAAAA        60
     TDRSAKLSSV QSALTRASLS GGTSRASTLG PQVVRKLATG ADLIRVQGRL APAELQRVLK       120
     ELQADPSVQY AEADVKLRRT ELRAGDVQPA LVPNDPFYQQ NQWHLHNAVG GINAPAAWDV       180
     SQGEGIVVAV IDTGILPQHP DLVGNLLEGY DFISDAETSR RPTNDRVPGA LDQGDWVEND       240
     NECYDGSLAE DSSWHGTHVA GTVAEQTNNG VGMAGVAYKA KVLPVRVLGK CGGYLSDIAD       300
     AVVWASGGTV TGIPANTNPA EIINMSLGGS GACGSTYQDA INGAISRGTT VVVAAGNETD       360
     NASKYRPASC EGVVTVGATR ITGGITYYSN YGTRVDLSGP GGGGSVDGNP GGYIWQTGSN       420
     AATTPDSGTP GYMGMGGTSM ASPHVAAVAA LVQSALIAKG KDPLTPAAMR TLLKETARPF       480
     PVAIPAATPI GTGILDAKAA LAKALEEPCT ENCGPVATPL TNKAAIGGLS GAAGSSKLYS       540
     FEAAAGKQFS VITYGGTGNV SVYVAEGREP SASDNDAKST RPGTSETVRV TKPVAATYYI       600
     KVVGEAAYNG VSILATQ                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page