(data stored in ACNUC7421 zone)

EMBL: CP001111.PE547

CP001111.PE547       Location/Qualifiers
FT   CDS             652676..653896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0547"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   xcb:XC_3572 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50252"
FT                   /db_xref="GOA:B4SJ84"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ84"
FT                   /protein_id="ACF50252.1"
FT                   /translation="MPNYRYKALNTHGEIFDGQMEAASEAELVARLQDQGHLPMETQLA
FT                   DGGAIGGSTWRNLFRQRPLQGAALLQFTQQLATLLGAGQPLDRALSILLGLPEDERSRR
FT                   AITDIRDVVRGGAPLSTALERQHGLFSRLYVNMVRAGEAGGSLHDTLQRLADYLERSRA
FT                   LQGKVINALVYPAILLVVVGGALLFLLGYVVPQFAQMYESLDVALPWFTNAVLQLGLFV
FT                   RDWWVLLLVVPAVLALFFERKARQPVFRLALDGWLLQRRGIGRLLGELETARLARTLGT
FT                   LLRNGVPLLGALGIARNVLGNRALAADVEAAADEVKNGTGLSLALSRGKRFPRLALQMI
FT                   QVGEESGALDTMLLKAADTFEQDSARRIDRLLAAMVPAITLVLASVVGAVIVAVLVPLY
FT                   DLTNAIG"
     MPNYRYKALN THGEIFDGQM EAASEAELVA RLQDQGHLPM ETQLADGGAI GGSTWRNLFR        60
     QRPLQGAALL QFTQQLATLL GAGQPLDRAL SILLGLPEDE RSRRAITDIR DVVRGGAPLS       120
     TALERQHGLF SRLYVNMVRA GEAGGSLHDT LQRLADYLER SRALQGKVIN ALVYPAILLV       180
     VVGGALLFLL GYVVPQFAQM YESLDVALPW FTNAVLQLGL FVRDWWVLLL VVPAVLALFF       240
     ERKARQPVFR LALDGWLLQR RGIGRLLGEL ETARLARTLG TLLRNGVPLL GALGIARNVL       300
     GNRALAADVE AAADEVKNGT GLSLALSRGK RFPRLALQMI QVGEESGALD TMLLKAADTF       360
     EQDSARRIDR LLAAMVPAIT LVLASVVGAV IVAVLVPLYD LTNAIG                      406
//

If you have problems or comments...

PBIL Back to PBIL home page