(data stored in ACNUC7421 zone)

EMBL: CP001111.PE548

CP001111.PE548       Location/Qualifiers
FT   CDS             653946..654389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0548"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: xcv:XCV3666 type
FT                   II secretory pathway pseudopilin"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50253"
FT                   /db_xref="GOA:B4SJ85"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ85"
FT                   /protein_id="ACF50253.1"
FT                   /translation="MIASRRPIRLSFTAARNQSGMSLLEIIIVIVLIGAVLTLVASRVL
FT                   GGADRGKANIAKAQVQTVASKVDNYQIDTGKLPGSLNDLVTAPAGVGGWLGPYAKPADL
FT                   NDPWGHALEYRAPGEGQPYELISLGKDGKAGGSSVDADIRYQP"
     MIASRRPIRL SFTAARNQSG MSLLEIIIVI VLIGAVLTLV ASRVLGGADR GKANIAKAQV        60
     QTVASKVDNY QIDTGKLPGS LNDLVTAPAG VGGWLGPYAK PADLNDPWGH ALEYRAPGEG       120
     QPYELISLGK DGKAGGSSVD ADIRYQP                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page