(data stored in ACNUC7421 zone)

EMBL: CP001111.PE551

CP001111.PE551       Location/Qualifiers
FT   CDS             655303..655935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0551"
FT                   /product="general secretion pathway protein J"
FT                   /note="KEGG: xcv:XCV3663 general secretion pathway protein
FT                   J"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50256"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ88"
FT                   /protein_id="ACF50256.1"
FT                   /translation="MKRRAAGFTLIEVMLATVLLAGGLALAFASVRSAMAVSQRGEQIA
FT                   AESERMRAVQALLRRQLAGALRTPLEVPDPTREPMFFQGEEQRMLFAADLPGYLGRGGP
FT                   YLHALQVDGRSGQQRLLLDLVLLQEGERIAETPPRPPEVLVDGLKSVQLRYRGIDASTG
FT                   QVTDWLPRWDDTRRLPMLVEVQIVPAKGAPWPVLVVAPRAGGSGGAR"
     MKRRAAGFTL IEVMLATVLL AGGLALAFAS VRSAMAVSQR GEQIAAESER MRAVQALLRR        60
     QLAGALRTPL EVPDPTREPM FFQGEEQRML FAADLPGYLG RGGPYLHALQ VDGRSGQQRL       120
     LLDLVLLQEG ERIAETPPRP PEVLVDGLKS VQLRYRGIDA STGQVTDWLP RWDDTRRLPM       180
     LVEVQIVPAK GAPWPVLVVA PRAGGSGGAR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page