(data stored in ACNUC7421 zone)

EMBL: CP001111.PE552

CP001111.PE552       Location/Qualifiers
FT   CDS             655932..656795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0552"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   xom:XOO_0777 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50257"
FT                   /db_xref="GOA:B4SJ89"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ89"
FT                   /protein_id="ACF50257.1"
FT                   /translation="MNRQGGAALVLVLWLIALMTALVGAFALSARVEHLQQRVLDDDAR
FT                   GQERARAGLEYALMRLSADPQRAPWRADGRTYRWTFDDASIEIKVLDENGKINLNLADV
FT                   ALLTAFLKALGEDEGAARQLAGAIVDWRDEDSLLQPGGGAEAPDYAAAGLPYGPRNKRF
FT                   ETLGELQRVLGMPGPLYQKMLPHLTLYSRQARPDPQFASAPVLTALGLDADTVLAQRAQ
FT                   QERDADTAAGATTLASSSGTYSIESRVIDGSGRRSVLQAVVRNGSGGVPGRSYTVLRWE
FT                   QGMTAR"
     MNRQGGAALV LVLWLIALMT ALVGAFALSA RVEHLQQRVL DDDARGQERA RAGLEYALMR        60
     LSADPQRAPW RADGRTYRWT FDDASIEIKV LDENGKINLN LADVALLTAF LKALGEDEGA       120
     ARQLAGAIVD WRDEDSLLQP GGGAEAPDYA AAGLPYGPRN KRFETLGELQ RVLGMPGPLY       180
     QKMLPHLTLY SRQARPDPQF ASAPVLTALG LDADTVLAQR AQQERDADTA AGATTLASSS       240
     GTYSIESRVI DGSGRRSVLQ AVVRNGSGGV PGRSYTVLRW EQGMTAR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page