(data stored in ACNUC7421 zone)

EMBL: CP001111.PE560

CP001111.PE560       Location/Qualifiers
FT   CDS             complement(665294..665659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_5934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50265"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ97"
FT                   /protein_id="ACF50265.1"
FT                   /translation="MRNSILLCVALMSVSALAQASSGSIRFSGHIAEPGCTTNLSQGEL
FT                   SLAACPPSAKGSTVAVTALADGQAATLRDGKRQGQKLSVSASAMRAGDIAFSERYSVQA
FT                   SKQQPLQGAYLVVVDYL"
     MRNSILLCVA LMSVSALAQA SSGSIRFSGH IAEPGCTTNL SQGELSLAAC PPSAKGSTVA        60
     VTALADGQAA TLRDGKRQGQ KLSVSASAMR AGDIAFSERY SVQASKQQPL QGAYLVVVDY       120
     L                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page