(data stored in ACNUC7421 zone)

EMBL: CP001111.PE561

CP001111.PE561       Location/Qualifiers
FT   CDS             666100..666639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0561"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: aby:ABAYE1856 putative
FT                   fimbrial protein precursor (pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50266"
FT                   /db_xref="GOA:B4SJ98"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ98"
FT                   /protein_id="ACF50266.1"
FT                   /translation="MHKINLIAAVMLAAAPLAANAADGTITFNGKVTDKTCTISTPGGK
FT                   DFAVNLPTVSKNTLANAGAVAGRTPFAINLTKCSAGNVATYFEPGSTVDFNTGRLLNQA
FT                   SANAATNVQLQLLGSNNQVLPIKAAGAGLAQTNSQWVTVGTDGSADLSYYAEYYATAAA
FT                   TPGDVTSSVKYTIIYN"
     MHKINLIAAV MLAAAPLAAN AADGTITFNG KVTDKTCTIS TPGGKDFAVN LPTVSKNTLA        60
     NAGAVAGRTP FAINLTKCSA GNVATYFEPG STVDFNTGRL LNQASANAAT NVQLQLLGSN       120
     NQVLPIKAAG AGLAQTNSQW VTVGTDGSAD LSYYAEYYAT AAATPGDVTS SVKYTIIYN        179
//

If you have problems or comments...

PBIL Back to PBIL home page