(data stored in ACNUC7421 zone)

EMBL: CP001111.PE563

CP001111.PE563       Location/Qualifiers
FT   CDS             667528..670113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0563"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: xfm:Xfasm12_0063 outer membrane usher
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50268"
FT                   /db_xref="GOA:B4SJA0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA0"
FT                   /protein_id="ACF50268.1"
FT                   /translation="MIGNRLTLSIHQALCLLVAGVACPGWALAAPANLGEQALMAQSGA
FT                   ANARAPESAQFNSSFLSGQAKQVDLAAFSNGNPMVAGTYRVDVYVNGAWQGRRDLQFKA
FT                   DAQGRVDACLPLPMLEEMGVDSEAVLLQQDPSVPADKTSCVPVQQRMSNAYGIYDSGNL
FT                   RYDLSIPQVFLRREARGYVNPALWDRGINAGFVGYSFNAINSDSRVEGGQRNRSAYLGL
FT                   NAGLNLGGWQFRHDSNLTWSEGDGRHWQSIATYAQRGIPQVRGMLTIGEAYTTGELFDS
FT                   IGYRGASLASDDRMLPDSLRGYAPVVRGIAETNARVEVRQNQQLIYSSTVSPGSFVIDD
FT                   LYPTGYGGDLEVSVIEADGRRREFKVPFGSVPQMLREGVSRYSLTAGQVRNKLLADEPW
FT                   LVQGTYQRGIGNQLTLYGGSALSDGYLSLLYGVGLSTPVGAFAADVTHARTTFDHYGNH
FT                   TGASVRLSYSNMIGETGTNLTLAAYRYSTEGFYSLQDALYGRDSDKRGIDPTTRGRQRS
FT                   QFQVTLNQPLGRRGGALYVTGSVRDFYDRPGTSKQYQVGYNNAWRSVNYGFSALRTEEG
FT                   LLGRSDTQYLLSMSVPLGRGTHPVSFSADVGVRDRGGYDNSRVGITGSAGVDNNFSYGA
FT                   ALSDSREGGTTAVGNAEYRSRYTALNATYSHSRDFRQASVGANGSVVVHPGGFTFTPQR
FT                   GDTMVLVEAPGARDAIVSNAPGLRVDGRGYAVVPYVSPYRLNTVTLDPQGMAHDVELES
FT                   TSQSVAPFAGAISYLRFDTRKGNALLIQVRNTDGRTLPFGAQVKDEQGQPVGMVSQGGR
FT                   LYVRSEKNQGQLQVEWGAGADQRCTIDYQVPAGADASKTGFIPLEAACR"
     MIGNRLTLSI HQALCLLVAG VACPGWALAA PANLGEQALM AQSGAANARA PESAQFNSSF        60
     LSGQAKQVDL AAFSNGNPMV AGTYRVDVYV NGAWQGRRDL QFKADAQGRV DACLPLPMLE       120
     EMGVDSEAVL LQQDPSVPAD KTSCVPVQQR MSNAYGIYDS GNLRYDLSIP QVFLRREARG       180
     YVNPALWDRG INAGFVGYSF NAINSDSRVE GGQRNRSAYL GLNAGLNLGG WQFRHDSNLT       240
     WSEGDGRHWQ SIATYAQRGI PQVRGMLTIG EAYTTGELFD SIGYRGASLA SDDRMLPDSL       300
     RGYAPVVRGI AETNARVEVR QNQQLIYSST VSPGSFVIDD LYPTGYGGDL EVSVIEADGR       360
     RREFKVPFGS VPQMLREGVS RYSLTAGQVR NKLLADEPWL VQGTYQRGIG NQLTLYGGSA       420
     LSDGYLSLLY GVGLSTPVGA FAADVTHART TFDHYGNHTG ASVRLSYSNM IGETGTNLTL       480
     AAYRYSTEGF YSLQDALYGR DSDKRGIDPT TRGRQRSQFQ VTLNQPLGRR GGALYVTGSV       540
     RDFYDRPGTS KQYQVGYNNA WRSVNYGFSA LRTEEGLLGR SDTQYLLSMS VPLGRGTHPV       600
     SFSADVGVRD RGGYDNSRVG ITGSAGVDNN FSYGAALSDS REGGTTAVGN AEYRSRYTAL       660
     NATYSHSRDF RQASVGANGS VVVHPGGFTF TPQRGDTMVL VEAPGARDAI VSNAPGLRVD       720
     GRGYAVVPYV SPYRLNTVTL DPQGMAHDVE LESTSQSVAP FAGAISYLRF DTRKGNALLI       780
     QVRNTDGRTL PFGAQVKDEQ GQPVGMVSQG GRLYVRSEKN QGQLQVEWGA GADQRCTIDY       840
     QVPAGADASK TGFIPLEAAC R                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page