(data stored in ACNUC7421 zone)

EMBL: CP001111.PE566

CP001111.PE566       Location/Qualifiers
FT   CDS             672590..674791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50271"
FT                   /db_xref="GOA:B4SJA3"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA3"
FT                   /protein_id="ACF50271.1"
FT                   /translation="MTQTGRSPLFASAAAFVLSGVVASAHAADSVAGQFAEWSGDSTVN
FT                   RQMSLRELGFRQPLVLSGQESQREIYLPVPAGVATRDAQLQLDGRYVRGHAGRTSGLWS
FT                   VDGDPIAARSITDAQGDASQLLAIDGEPRQNGFVRVGVGWWSIVSDYQCADQSAPANVL
FT                   RLSPDSRFSYRFDGRAVDTVAKAWGALPPRVRLLVDGRALQAPVYDAAWRIGTALQAGG
FT                   KQVQVVALPKVGDSVDLTGISIPASLQGVPAYAALASGERAYVLKDLAEVGVLLSLRDS
FT                   GPLAADAMIGSDALRAGVRAALDALAAQVGATGADAGTAFAAWRGTGMGGLEKPADNGS
FT                   VSVVAVAGRPTLVVDPAAAGKVAGLFADQWRSYALGRSLQVTAAGMPKLDGDQVLLSRL
FT                   GNIAGTMDVVTRADRSATFDLGALSADGRLPEQVVIDVSAAPNAAGQGAVATIYFNDYL
FT                   LGGKVLAANGQPQRLVAKVPAYALSARNEIRVSFLRQPARPYCHDPATGYPVSILPSSH
FT                   LTLAKRSLGSDFVGASSQLSRGSQVFVPGTWLQDAPTSLAKVIAIASAVGASPEASELK
FT                   VVDAGAAVSPGAPWLAFGVAPAGVDVAGLKDGHLLIGGTPQPLLDVSGLDRAAVVQVGT
FT                   SGGQLGVLYSDLGAQAPSFGAPFRLLRGDLAVLDGSDAVREFDRQDPYGSRVAEDGNPQ
FT                   SKWERHMVWLLLLVGVIVFALLAARVTQVRRRKSANTGH"
     MTQTGRSPLF ASAAAFVLSG VVASAHAADS VAGQFAEWSG DSTVNRQMSL RELGFRQPLV        60
     LSGQESQREI YLPVPAGVAT RDAQLQLDGR YVRGHAGRTS GLWSVDGDPI AARSITDAQG       120
     DASQLLAIDG EPRQNGFVRV GVGWWSIVSD YQCADQSAPA NVLRLSPDSR FSYRFDGRAV       180
     DTVAKAWGAL PPRVRLLVDG RALQAPVYDA AWRIGTALQA GGKQVQVVAL PKVGDSVDLT       240
     GISIPASLQG VPAYAALASG ERAYVLKDLA EVGVLLSLRD SGPLAADAMI GSDALRAGVR       300
     AALDALAAQV GATGADAGTA FAAWRGTGMG GLEKPADNGS VSVVAVAGRP TLVVDPAAAG       360
     KVAGLFADQW RSYALGRSLQ VTAAGMPKLD GDQVLLSRLG NIAGTMDVVT RADRSATFDL       420
     GALSADGRLP EQVVIDVSAA PNAAGQGAVA TIYFNDYLLG GKVLAANGQP QRLVAKVPAY       480
     ALSARNEIRV SFLRQPARPY CHDPATGYPV SILPSSHLTL AKRSLGSDFV GASSQLSRGS       540
     QVFVPGTWLQ DAPTSLAKVI AIASAVGASP EASELKVVDA GAAVSPGAPW LAFGVAPAGV       600
     DVAGLKDGHL LIGGTPQPLL DVSGLDRAAV VQVGTSGGQL GVLYSDLGAQ APSFGAPFRL       660
     LRGDLAVLDG SDAVREFDRQ DPYGSRVAED GNPQSKWERH MVWLLLLVGV IVFALLAARV       720
     TQVRRRKSAN TGH                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page