(data stored in ACNUC7421 zone)

EMBL: CP001111.PE568

CP001111.PE568       Location/Qualifiers
FT   CDS             676942..679764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0568"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: dac:Daci_2942 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50273"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA5"
FT                   /protein_id="ACF50273.1"
FT                   /translation="MKTTLLSTVIAIALATATAPVLAQADAPLPLSGAAYRIAEQAFAA
FT                   YERGDYPAAYQQSSEAIRLRPDVVRLRLLQIYALQKLGRGAEAQQRARRALDAGMKDPA
FT                   LPALAAAVPKTTTGAARSAALPRASATAADRNSRQAYLLATEAYAAYDAGQMGIAASKA
FT                   EQAFRQQPKQGAWALLWVAALEAQQQPEQADVAISTALQLGAPNVEELRARRVVLTRQR
FT                   ALLLAQQAYRSLSAGDDAAAIGHARDAVKLAPEVASYRLLLITAQLQGDQLADAEHSAD
FT                   QALQVDANDLNARVMRGYLRQRQGSTLRANEDFDAALATPGSTAQQRNVRLLAVDAALA
FT                   AGDRVRAAALLAPLQAPVPADEKDARAQLLLQQGIEQRAKAISSSRALPRISAEAYPAP
FT                   VQHCQSGDSSNVCELMPADLQGDGGAAQRAYAAYARRDYADAIGEARQAVQLAPEDVNL
FT                   QGLLTTALAAGNRVQQDEARQRLDAALAQHPDDAGALMQRGYLNQKAREPARALADFHA
FT                   AEATGKAPKSVVLDQAYASAANGDHPQAVTLLRSAIDRADAGELPLDEHQRYNVRNAIA
FT                   NYSREWGVIASAGFRGARQAATNVGGAAISTPGDSVFSTLEAFWRPPAFNDQHGTLELY
FT                   ARLLNTLYDEGGTYESIRAVDPCTGESTPDARARAERLSHSRSTTGWPSTIASFGMRYA
FT                   FGQTGLSAGIERRQFLGSATRQGEVYPASAAVQCRLQLALNPPLEASTLARYRLASGSG
FT                   GWMSYLTYGYYHGTDLRTDVNQWWMVSGYAQGGYTWDDNGASFTLDALDANGTPVRRVG
FT                   EANGRLHREQWFAAGELRAGRSFRFGSGQTHWVVTPYVVIGADWLDQRSRVRDLRYPLL
FT                   PSQSFALNDSQRSWSLGAGPGVGVRYWFREDHYNTPRSYLDLTVQYRFAIGGGDTQRAK
FT                   GLFATAILYY"
     MKTTLLSTVI AIALATATAP VLAQADAPLP LSGAAYRIAE QAFAAYERGD YPAAYQQSSE        60
     AIRLRPDVVR LRLLQIYALQ KLGRGAEAQQ RARRALDAGM KDPALPALAA AVPKTTTGAA       120
     RSAALPRASA TAADRNSRQA YLLATEAYAA YDAGQMGIAA SKAEQAFRQQ PKQGAWALLW       180
     VAALEAQQQP EQADVAISTA LQLGAPNVEE LRARRVVLTR QRALLLAQQA YRSLSAGDDA       240
     AAIGHARDAV KLAPEVASYR LLLITAQLQG DQLADAEHSA DQALQVDAND LNARVMRGYL       300
     RQRQGSTLRA NEDFDAALAT PGSTAQQRNV RLLAVDAALA AGDRVRAAAL LAPLQAPVPA       360
     DEKDARAQLL LQQGIEQRAK AISSSRALPR ISAEAYPAPV QHCQSGDSSN VCELMPADLQ       420
     GDGGAAQRAY AAYARRDYAD AIGEARQAVQ LAPEDVNLQG LLTTALAAGN RVQQDEARQR       480
     LDAALAQHPD DAGALMQRGY LNQKAREPAR ALADFHAAEA TGKAPKSVVL DQAYASAANG       540
     DHPQAVTLLR SAIDRADAGE LPLDEHQRYN VRNAIANYSR EWGVIASAGF RGARQAATNV       600
     GGAAISTPGD SVFSTLEAFW RPPAFNDQHG TLELYARLLN TLYDEGGTYE SIRAVDPCTG       660
     ESTPDARARA ERLSHSRSTT GWPSTIASFG MRYAFGQTGL SAGIERRQFL GSATRQGEVY       720
     PASAAVQCRL QLALNPPLEA STLARYRLAS GSGGWMSYLT YGYYHGTDLR TDVNQWWMVS       780
     GYAQGGYTWD DNGASFTLDA LDANGTPVRR VGEANGRLHR EQWFAAGELR AGRSFRFGSG       840
     QTHWVVTPYV VIGADWLDQR SRVRDLRYPL LPSQSFALND SQRSWSLGAG PGVGVRYWFR       900
     EDHYNTPRSY LDLTVQYRFA IGGGDTQRAK GLFATAILYY                             940
//

If you have problems or comments...

PBIL Back to PBIL home page