(data stored in ACNUC7421 zone)

EMBL: CP001111.PE57

CP001111.PE57        Location/Qualifiers
FT   CDS             complement(66823..67026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_4218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49762"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP2"
FT                   /protein_id="ACF49762.1"
FT                   /translation="MDTYSPAEIVEHLAALRAEHRLLDEQITRMAANGEDELESKRLKR
FT                   RKLQLKDCIAKLESLQIPDEPA"
     MDTYSPAEIV EHLAALRAEH RLLDEQITRM AANGEDELES KRLKRRKLQL KDCIAKLESL        60
     QIPDEPA                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page