(data stored in ACNUC7421 zone)

EMBL: CP001111.PE571

CP001111.PE571       Location/Qualifiers
FT   CDS             complement(682345..684009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0571"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xom:XOO_3642 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50276"
FT                   /db_xref="GOA:B4SJA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA8"
FT                   /protein_id="ACF50276.1"
FT                   /translation="MSSQYIYTMNRVSKVVPPKRQIIKDISLSFFPGAKIGLLGLNGAG
FT                   KSTVLKIMAGVDTDFEGEARPQAGIKVGYLAQEPELDPTKTVREAVEEGVGEVLQAQAA
FT                   LEAVYAAYAEEGADFDALAKEQERLEAILAAGDAHTLENQLDVAADALRLPPWEAIVGK
FT                   LSGGEKRRVALCRLLLQKPDMLLLDEPTNHLDAESVEWLEQFLARYTGTVVAVTHDRYF
FT                   LDNAAEWILELDRGRGIPWKGNYTDWLTQKDERLKQEDNQEKARQKAIQKELEWSRQNA
FT                   KGGRTKGKARLARLEELQSVDYQKRNETNEIFIPPGERLGNAVMEFKNVSKKFGDRLLF
FT                   DNLSFLVPGGAIVGIIGPNGAGKSTLFKMITGQEKPDTGEIVVGPTVQLSYVDQSRDAL
FT                   EGNHSVFQEIAGGLDILNINGIEIQSRAYIGRFNFKGQDQQKMVGSLSGGERGRLHMAK
FT                   TLLQGGNVLLLDEPSNDLDIETLRALEDALLEFPGNTFVISHDRWFLDRIATHILAFEG
FT                   DSHVEFFQGNYREYEEDKRRRMGDDAAPKRLRFKALK"
     MSSQYIYTMN RVSKVVPPKR QIIKDISLSF FPGAKIGLLG LNGAGKSTVL KIMAGVDTDF        60
     EGEARPQAGI KVGYLAQEPE LDPTKTVREA VEEGVGEVLQ AQAALEAVYA AYAEEGADFD       120
     ALAKEQERLE AILAAGDAHT LENQLDVAAD ALRLPPWEAI VGKLSGGEKR RVALCRLLLQ       180
     KPDMLLLDEP TNHLDAESVE WLEQFLARYT GTVVAVTHDR YFLDNAAEWI LELDRGRGIP       240
     WKGNYTDWLT QKDERLKQED NQEKARQKAI QKELEWSRQN AKGGRTKGKA RLARLEELQS       300
     VDYQKRNETN EIFIPPGERL GNAVMEFKNV SKKFGDRLLF DNLSFLVPGG AIVGIIGPNG       360
     AGKSTLFKMI TGQEKPDTGE IVVGPTVQLS YVDQSRDALE GNHSVFQEIA GGLDILNING       420
     IEIQSRAYIG RFNFKGQDQQ KMVGSLSGGE RGRLHMAKTL LQGGNVLLLD EPSNDLDIET       480
     LRALEDALLE FPGNTFVISH DRWFLDRIAT HILAFEGDSH VEFFQGNYRE YEEDKRRRMG       540
     DDAAPKRLRF KALK                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page