(data stored in ACNUC7421 zone)

EMBL: CP001111.PE572

CP001111.PE572       Location/Qualifiers
FT   CDS             684265..684738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50277"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA9"
FT                   /protein_id="ACF50277.1"
FT                   /translation="MRINRVMAGAVASVLALGAVAPAFADNDHRHDHDRREWREDRREW
FT                   RQDRREWERDRREARRDYRQDRREWHRDHDRYYRPAPPRVVYRPAYGPGYGWKVGHRYR
FT                   DYYRGPVYVVNDYPRYQLRRPPYGHQWIRDDRGNMLLVAIATGVIAQYVLSSR"
     MRINRVMAGA VASVLALGAV APAFADNDHR HDHDRREWRE DRREWRQDRR EWERDRREAR        60
     RDYRQDRREW HRDHDRYYRP APPRVVYRPA YGPGYGWKVG HRYRDYYRGP VYVVNDYPRY       120
     QLRRPPYGHQ WIRDDRGNML LVAIATGVIA QYVLSSR                                157
//

If you have problems or comments...

PBIL Back to PBIL home page