(data stored in ACNUC7421 zone)

EMBL: CP001111.PE573

CP001111.PE573       Location/Qualifiers
FT   CDS             684926..686179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0573"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   xcb:XC_3544 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50278"
FT                   /db_xref="GOA:B4SJB0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJB0"
FT                   /protein_id="ACF50278.1"
FT                   /translation="MFPRDVRIESYDPELAKAIAAETQRQEDHVELIASENYTSPAVME
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDIAEQLAIDRLKQLFGADYANVQPHSGSQANQA
FT                   VYFALLQPGDTILGMSLAHGGHLTHGAKVNASGKLFNAVQYGVNDQGLIDYDEVERLAL
FT                   EHKPKMVVAGFSAYSQVIDWARFRAIADKVGAYLFVDMAHVAGLVAAGVYPSPLEHAHV
FT                   VTSTTHKTLRGPRGGIIVAKGAGEDLVKKLQSIVFPGIQGGPLMHVIAGKAVAFKEALE
FT                   PGFKAYQQQVVKNAQAMANTLIARGYKIVSGGTQNHLMLVDMIGKDVSGKDAEAALGKA
FT                   HITVNKNSVPNDPRSPFVTSGLRLGTPAVTTRGYVEQDCVDLANWIADVLDAPSDDAVI
FT                   ARVRDAVSAQCRKYPVYG"
     MFPRDVRIES YDPELAKAIA AETQRQEDHV ELIASENYTS PAVMEAQGSQ LTNKYAEGYP        60
     GKRYYGGCEY VDIAEQLAID RLKQLFGADY ANVQPHSGSQ ANQAVYFALL QPGDTILGMS       120
     LAHGGHLTHG AKVNASGKLF NAVQYGVNDQ GLIDYDEVER LALEHKPKMV VAGFSAYSQV       180
     IDWARFRAIA DKVGAYLFVD MAHVAGLVAA GVYPSPLEHA HVVTSTTHKT LRGPRGGIIV       240
     AKGAGEDLVK KLQSIVFPGI QGGPLMHVIA GKAVAFKEAL EPGFKAYQQQ VVKNAQAMAN       300
     TLIARGYKIV SGGTQNHLML VDMIGKDVSG KDAEAALGKA HITVNKNSVP NDPRSPFVTS       360
     GLRLGTPAVT TRGYVEQDCV DLANWIADVL DAPSDDAVIA RVRDAVSAQC RKYPVYG          417
//

If you have problems or comments...

PBIL Back to PBIL home page