(data stored in ACNUC7421 zone)

EMBL: CP001111.PE58

CP001111.PE58        Location/Qualifiers
FT   CDS             67117..68013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0058"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: xcv:XCV4328
FT                   putative PP-loop family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49763"
FT                   /db_xref="GOA:B4SRP3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRP3"
FT                   /protein_id="ACF49763.1"
FT                   /translation="MTAVISLPDPPQRASRGPRVAGPGQDRLGKRLRRQVGQAIADFGM
FT                   IEAGDKVMVCLSGGKDSYTLLDLLLQLQKRAPVPFELVAVNLDQKQPGFPEHVLPEYLA
FT                   ALGVPYQIIEQDTYSVVSRVIPEGRTMCSLCSRLRRGALYNHAKAHGFTRIALGHHCDD
FT                   MVATLFMNLFHHAKLAAMPPKLLSDDGQHVVIRPLAYVREHDIAEYAQARRFPIIPCTL
FT                   CGSQESLQRRQVGLMLKQWDQDHPGRIEQIARAMADVRPAQLADATLFDFRALGHSGHA
FT                   AHADAWLADAVPETPAD"
     MTAVISLPDP PQRASRGPRV AGPGQDRLGK RLRRQVGQAI ADFGMIEAGD KVMVCLSGGK        60
     DSYTLLDLLL QLQKRAPVPF ELVAVNLDQK QPGFPEHVLP EYLAALGVPY QIIEQDTYSV       120
     VSRVIPEGRT MCSLCSRLRR GALYNHAKAH GFTRIALGHH CDDMVATLFM NLFHHAKLAA       180
     MPPKLLSDDG QHVVIRPLAY VREHDIAEYA QARRFPIIPC TLCGSQESLQ RRQVGLMLKQ       240
     WDQDHPGRIE QIARAMADVR PAQLADATLF DFRALGHSGH AAHADAWLAD AVPETPAD         298
//

If you have problems or comments...

PBIL Back to PBIL home page