(data stored in ACNUC7421 zone)

EMBL: CP001111.PE59

CP001111.PE59        Location/Qualifiers
FT   CDS             68050..68955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0059"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: xcv:XCV4327
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49764"
FT                   /db_xref="GOA:B4SRP4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRP4"
FT                   /protein_id="ACF49764.1"
FT                   /translation="MFFRNLTFFRFPTTTDFSEVDTLLPHALLKPVGALEMNSRGFISP
FT                   FGREEKELLSHRIAEHLWLTVGGEDKILPAAVVNDLLERKLEEIEEKEGRRPGGRERKR
FT                   MKDDLLHELLPRAFVKSSRNDAFIDLQHGYVAVDTSSRKTGEYFMSDIRGLLGSFPAMP
FT                   LNAEVAPRSILTGWIAGEPLPTGLSLGEECEMKDPVEGGAVVKCQHQELRCDEIDKHLD
FT                   AGKQVTKLALIFEDNLSFVIGDDLIVRKLKFLDGALDQLEHADEDGRRAEFDARFALQS
FT                   AEIRRLFLLLEEAFKLSKAD"
     MFFRNLTFFR FPTTTDFSEV DTLLPHALLK PVGALEMNSR GFISPFGREE KELLSHRIAE        60
     HLWLTVGGED KILPAAVVND LLERKLEEIE EKEGRRPGGR ERKRMKDDLL HELLPRAFVK       120
     SSRNDAFIDL QHGYVAVDTS SRKTGEYFMS DIRGLLGSFP AMPLNAEVAP RSILTGWIAG       180
     EPLPTGLSLG EECEMKDPVE GGAVVKCQHQ ELRCDEIDKH LDAGKQVTKL ALIFEDNLSF       240
     VIGDDLIVRK LKFLDGALDQ LEHADEDGRR AEFDARFALQ SAEIRRLFLL LEEAFKLSKA       300
     D                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page