(data stored in ACNUC7421 zone)

EMBL: CP001111.PE62

CP001111.PE62        Location/Qualifiers
FT   CDS             71106..73529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0062"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; KEGG: reu:Reut_B4471
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49767"
FT                   /db_xref="GOA:B4SRP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP7"
FT                   /protein_id="ACF49767.1"
FT                   /translation="MRTSTVNAAGLPAAVAVMACLMLPATASAAGCETPLRIAWPSDRA
FT                   PLSSAIEGQAEGVSAAYLNLLGEQRPLQAQPLPATAVVEGLLPPATQALLGWPRSQLPS
FT                   GWVASAPYLQLPQVIVRRADARPVLGLEDLRERAVASPDRLPLAALLAEQAPGAQLLPP
FT                   APLDDALSLLGTGLVDAVIANLGEVEAGLRRYQGDRLVIAAPAGFDDALVLATVPACAG
FT                   VIPGFEQAVSQLTDTQRDVIRTGWLPDQPRNPPSSSPLRWLVPASLILLALALVYAFGY
FT                   WRVHRESARRRVAAQRLQEVTANLPAVVYQARRTATGDYSFPQIAGDVQALFGVSVETA
FT                   RIDHPRLLAAVHPDDRTLVMDCVEAAALARGPIDVTFRTRSPQGWRWVHSQGRTLACDD
FT                   SNVEWSGYWMDVSEVHTRTQALADARREAEQAALAKTHFLATMSHEIRTPMSTLLGMLE
FT                   RLAASDLDHRQQQVLATIGDAAQMLRQILDDVLHSQRLQPAPLQRQPTDLAALLRAVQQ
FT                   LLLPVAASRGLYLQIHLDPALQAGSLADSLRLRQILFNLVGNALKFTLHGGVELRVQVL
FT                   QQHAQGQRLRLQVSDSGVGISAERQQAVFGAYTQAEASTTRRFGGSGLGLAICRELAVS
FT                   MGGDLQLHSATGEGTTVWLELDLSACELPAGAPSPAIAEEQPLPPARVLVAEDHPTNLQ
FT                   LLEQRLHDLGLQVHACADGAQALQAWQSQPFELVITDCHMPGMNGFALARAIRADTCQH
FT                   RARVPIIALTASVLERTREACRDAGIDHFLAKPVEPRELRALLAVLLAPDSVRQ"
     MRTSTVNAAG LPAAVAVMAC LMLPATASAA GCETPLRIAW PSDRAPLSSA IEGQAEGVSA        60
     AYLNLLGEQR PLQAQPLPAT AVVEGLLPPA TQALLGWPRS QLPSGWVASA PYLQLPQVIV       120
     RRADARPVLG LEDLRERAVA SPDRLPLAAL LAEQAPGAQL LPPAPLDDAL SLLGTGLVDA       180
     VIANLGEVEA GLRRYQGDRL VIAAPAGFDD ALVLATVPAC AGVIPGFEQA VSQLTDTQRD       240
     VIRTGWLPDQ PRNPPSSSPL RWLVPASLIL LALALVYAFG YWRVHRESAR RRVAAQRLQE       300
     VTANLPAVVY QARRTATGDY SFPQIAGDVQ ALFGVSVETA RIDHPRLLAA VHPDDRTLVM       360
     DCVEAAALAR GPIDVTFRTR SPQGWRWVHS QGRTLACDDS NVEWSGYWMD VSEVHTRTQA       420
     LADARREAEQ AALAKTHFLA TMSHEIRTPM STLLGMLERL AASDLDHRQQ QVLATIGDAA       480
     QMLRQILDDV LHSQRLQPAP LQRQPTDLAA LLRAVQQLLL PVAASRGLYL QIHLDPALQA       540
     GSLADSLRLR QILFNLVGNA LKFTLHGGVE LRVQVLQQHA QGQRLRLQVS DSGVGISAER       600
     QQAVFGAYTQ AEASTTRRFG GSGLGLAICR ELAVSMGGDL QLHSATGEGT TVWLELDLSA       660
     CELPAGAPSP AIAEEQPLPP ARVLVAEDHP TNLQLLEQRL HDLGLQVHAC ADGAQALQAW       720
     QSQPFELVIT DCHMPGMNGF ALARAIRADT CQHRARVPII ALTASVLERT REACRDAGID       780
     HFLAKPVEPR ELRALLAVLL APDSVRQ                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page